Property Summary

NCBI Gene PubMed Count 85
PubMed Score 152.02
PubTator Score 166.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Obesity 616
Disease Target Count P-value
psoriasis 6685 3.2e-76
Atopic dermatitis 944 3.8e-08
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -3.800 3.8e-08
psoriasis -2.200 3.2e-76

Gene RIF (79)

PMID Text
27322007 Vaspin might be a useful predictive biomarker in patients with AMI, and patients with low vaspin levels might have a high risk of a MACE. In addition, vaspin might have protective effects on the improvement of LVEF after AMI.
26670468 The development of clinically manifest arthritis after follow-up was associated with baseline serum vaspin levels.
26436376 serum visceral adipose tissue-derived serpin (vaspin) levels in patients with normal glucose regulation and recently diagnosed type 2 diabetes, was investigated.
26415032 Low vaspin blood levels in patients with prolactinomas.
26199422 structural and functional results reveal the mechanistic basis of how reactive centre loop sequence and exosite interaction in vaspin enable KLK7 recognition and regulate protease inhibition
25945347 It is believed that vaspin could be regarded as a new link between obesity and related metabolic disorders, including glucose intolerance.
25915077 Mean vaspin and apelin levels were significantly lower in underweight children compared to controls
25672472 In the sepsis group, vaspin plasma concentration was about three-fold as high as in the median surgical control group.
25470626 High levels of serum vaspin is associated with obesity.
25340725 vaspin is a beneficial adipokine in obesity
25151227 Higher vaspin levels are associated with obesity and type 2 diabetes mellitus.
25133192 Serum vaspin levels showed no significant difference between the type 2 diabetics with renal insufficiency and without renal insufficiency.
24929806 during pregnancy, high vaspin concentration is significantly associated with insulin resistance in gestational diabetes mellitus
24596079 The expression of human vaspin (serpinA12) is positively correlated to body mass index and insulin sensitivity and increases glucose tolerance in vivo, suggesting a compensatory role in response to diminished insulin signaling in obesity.
24530312 Vaspin rs2236242 gene polymorphism is associated with polycystic ovary syndrome risk.
24529152 serum vaspin level was positively associated with c-IMT, independently of insulin resistance in a general population.
24367155 the correlations of visfatin/Nampt, vaspin, and RBP-4 with insulin resistance are tissue dependent.
24166663 Serum vaspin concentrations are elevated in patients with ulcerative colitis.
23992351 vaspin is an adipokine that may have a role in metabolic syndrome in males
23896633 Low levels of circulating adiponectin and vaspin levels are associated with an increased risk of developing endometrial cancer.
23850850 The plasma vaspin concentrations correlate with the severity of coronary artery disease.
23756768 A rare variant (rs61757459) in vaspin coding for the stop codon p.R211X is related to lower circulating vaspin (SERPINA12) concentrations. Structure analysis suggests misfolding and instability due to the absence of core structural domains.
23594688 Vaspin levels have been shown to increase in acute ischemic stroke patients. The increased vaspin levels may vary depending on several factors in acute period of ischemic stroke.
23490415 possible alterations in cord blood levels of insulin and the adipokines vaspin and omentin-1 were investigated in large-for-gestational age and appropriate-for-gestational age infants.
23474107 The observed higher levels of omentin-1, visfatin, and vaspin in patients with colorectal cancer (CRC), independent of measures of obesity, suggest that these adipocytokines may have a potential role in the development of CRC.
23466514 Insulin administration down-regulates serum vaspin levels.
23370777 Vaspin treatment of isolated pancreatic islets leads to increased insulin concentration in the media upon glucose stimulation without influencing insulin secretion.
23359189 Our study showed that the serum vaspin level is decreased in chronic hepatitis C patients with non-advanced fibrosis
23342091 data suggest that serum vaspin concentrations might modulate human eating behaviour
23318644 Cross-sectional data on South Korean 9-year-olds suggest that overweight boys and girls have higher vaspin and leptin serum levels than boys and girls of normal weight, whereas only overweight boys have higher visfatin levels than normal weight boys.
23307819 Vaspin is a novel ligand for the cell-surface GRP78/voltage-dependent anion channel complex in endothelial cells and promotes proliferation, inhibits apoptosis, and protects vascular injuries in diabetes mellitus.
23225237 metformin therapy reduces vaspin concentration in a gender-specific manner. Metformin exerts little benefit in increasing adiponectin levels in diabetes patients.
23206815 Creatinine levels correlate hegatively with serum vaspin levels and are significantly reduced in Japanese patients with hemodialyais therapy in the low vaspin group.
23206449 A significant inverse association was found, in patients with type 2 diabetes mellitus, between serum vaspin concentration and the presence of carotid plaque.
23160181 common and rare variants in FTO, SERPINA12, and ITGAL predict PON1 acti
23135225 Vaspin inhibited the apoptosis of human osteoblasts through ERK signaling pathway.
23123830 Variants of the vaspin gene are associated with serum vaspin levels and with the risk for coronary artery disease in the Chinese population.
23041430 Serum vaspin cannot independently predict gestational diabetes mellitus and it is not affected by the degree of glucose metabolism deregulation or the exogenous administration of insulin.
22982016 Finding showed that there are significant differences in genotype frequencies between the groups regarding vaspin rs2236242 polymorphism (chi(2)=18.74, p<0.0001). A significant protection against Metabolic syndrome was found for vaspin rs2236242 in allele and genotypes
22907691 Variability in serum vaspin concentrations might be explained by its genetic variants.
22539588 Serum vaspin levels were related to insulin resistance, and higher levels of serum vaspin in 7% of the Japanese population are closely linked to minor allele sequence (A) of rs77060950.
22417310 The anti-inflammatory adipokine vaspin is discussed as a new link between inflammation and obesity. We demonstrate that - different from healthy controls - vaspin serum levels in patients with psoriasis were body mass index independent.
22246907 Serum vaspin concentration seems to reflect intensity of liver angiogenesis in chronic hepatitis C patients.
22116078 circulating vaspin levels have an effect on metabolic variables in elderly twins
22032341 Our study is the first report on the new adipokines vaspin and omentin in patients with JIA, and it shows that omentin is significantly higher in juvenile idiopathic arthritis patients in comparison with healthy controls.
21893030 The present study indicates that vaspin protects vascular endothelial cells from FFA-induced apoptosis through upregulation of the PI3-kinase/Akt signaling pathway.
21798959 We herein present novel data indicating SERPINA12 levels are neither altered in overt and subclinical hypothyroidism
21738955 Data indicating a possible role of leptin, adiponectin, visfatin, chemerin and vaspin in the pathogenesis of chronic hepatitis are summarized.
21646731 Vaspin expression in abdominal adipose tissue was adipocyte-specific and vaspin expression in subcutaneous adipose tissue decreased as visceral adipose tissue area increased.
21545478 Higher plasma vaspin concentrations are significantly associated with metabolic syndrome in men. In women, vaspin concentrations are associated with coronary atherosclerosis.
21513939 there is a complex interplay between epicardial fat thickness, serum vaspin, and liver histology in promoting an impaired hyperemic stimulation of coronary blood flow in patients with NAFLD
21442174 Letter: serum vaspin levels were not significantly different in patients with Kawasaki disease compared to controls.
20975299 Vaspin serum concentrations are decreased by exercise-induced oxidative stress, but not by exercise-associated improvement in insulin sensitivity.
20850423 Decreased vaspin and increased visfatin serum levels were observed in asymptomatic patients with coronary artery disease.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626239 Presence of increased vaspin and higher insulin resistance values in women with polycystic ovary syndrome could contribute to increased diabetogenic and atherogenic risk in these patients.
20605615 both vaspin and visfatin/Nampt might play an important role in the pathogenesis of T2DM.
20580037 Serum vaspin levels are raised in patients with nonalcoholic fatty liver disease regardless of potential confounders and represent an independent predictor of liver fibrosis scores
20488498 lower maternal vaspin concentrations in cases of vaginal delivery may be attributed to spontaneous term delivery inflammation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20156923 Serum vaspin levels have a meal-related diurnal variation, suggesting a role for vaspin in metabolic regulation
20095887 Vaspin serum concentrations are altered in patients with non-alcoholic fatty liver disease.
20060144 visceral adipose tissue area was independently correlated with serum vaspin concentrations in the higher insulin resistance group
20045145 Circulating vaspin levels are not significantly different between gestational diabetes mellitus, preeclampsia, and control subjects and do not correlate with insulin sensitivity in pregnant subjects
20018186 Serum vaspin level is one of the predictors for insulin resistance
19952124 Our results support the existence of a sexual dimorphism regarding circulating vaspin but find no major role for vaspin concerning insulin sensitivity in nondiabetic humans.
19951565 Serum vaspin level is higher in diabetic patients than that in NGT subjects in women. Age predicts serum vaspin level in NGT subjects, while PG2h is independently associated with vaspin in diabetic patients.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19816707 the first study to show that high body fatness along with low CRF might contribute to increased vaspin concentrations in Korean young men.
19554505 Vaspin is expressed in the human placenta and is regulated by nutrtional status.
19356820 Higher vaspin(SERPINA12) and lower adiponectin levels in obese children: these adipokines are significantly correlated with insulin sensitivity indices in this age.
19114623 Serum vaspin concentrations in premenopausal women are not affected by polycystic ovary syndrome, obesity, or glucose tolerance disorders.
18848328 Low vaspin serum concentrations correlate with recently experienced ischemic events in patients with carotid stenosis despite the lack of an association between circulating vaspin and parameters of atherosclerosis severity.
18800627 may be the compensatory molecule in the pathogenesis of metabolic syndrome. (review)
18726871 results demonstrate a significant association of vaspin SNP rs2236242 with T2DM in the KORA F3 study with the AA genotype bearing an increased risk (adjusted OR 2.35 [1.59; 3.46] versus AT/TT).
18726871 Observational study of gene-disease association. (HuGE Navigator)
18375437 Elevated serum and omental adipose tissue levels of vaspin in overweight polycystic ovary syndrome women and ex vivo regulation of vaspin expression.
17991760 Low circulating vaspin correlates with a high fitness level, whereas physical training in untrained individuals causes increased vaspin serum concentrations.
16298335 Induction of human vaspin mRNA expression in adipose tissue is regulated in a fat depot-specific manner and could be associated with parameters of obesity, insulin resistance, and glucose metabolism.

AA Sequence

MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGR      1 - 70
NIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFI     71 - 140
DQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFF    141 - 210
RARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKL    211 - 280
KHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVG    281 - 350
EAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK          351 - 414
//

Text Mined References (85)

PMID Year Title
27322007 2016 Vaspin as a Prognostic Marker in Patients with Acute Myocardial Infarction.
26670468 2015 Serum Vaspin Levels Are Associated with the Development of Clinically Manifest Arthritis in Autoantibody-Positive Individuals.
26436376 2015 Changes and clinical significance of serum vaspin levels in patients with type 2 diabetes.
26415032 2016 Serum vaspin and adiponectin levels in patients with prolactinoma.
26199422 2015 A unique serpin P1' glutamate and a conserved ?-sheet C arginine are key residues for activity, protease recognition and stability of serpinA12 (vaspin).
25945347 2015 The role of vaspin in the development of metabolic and glucose tolerance disorders and atherosclerosis.
25915077 2015 Role of circulating adipocytokines vaspin, apelin, and visfatin in the loss of appetite in underweight children: a pilot trial.
25672472 2015 Increased plasma vaspin concentration in patients with sepsis: an exploratory examination.
25470626 The comparison of serum vaspin and visfatin concentrations in obese and normal weight women.
25340725 2014 Increased vaspin levels are associated with beneficial metabolic outcome pre- and post-bariatric surgery.
25151227 2014 Higher vaspin levels in subjects with obesity and type 2 diabetes mellitus: a meta-analysis.
25133192 2014 Association of serum vaspin and adiponectin levels with renal function in patients with or without type 2 diabetes mellitus.
24929806 2015 Comparative analysis of vaspin in pregnant women with and without gestational diabetes mellitus and healthy non-pregnant women.
24596079 2014 Vaspin (serpinA12) in obesity, insulin resistance, and inflammation.
24530312 2014 Association between vaspin rs2236242 gene polymorphism and polycystic ovary syndrome risk.
24529152 2014 Serum vaspin levels are positively associated with carotid atherosclerosis in a general population.
24367155 2013 Associations between tissue visfatin/nicotinamide, phosphoribosyltransferase (Nampt), retinol binding protein-4, and vaspin concentrations and insulin resistance in morbidly obese subjects.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24166663 2014 High serum vaspin concentrations in patients with ulcerative colitis.
23992351 2013 Association between serum vaspin level and metabolic syndrome in healthy Korean subjects.
23896633 2013 Evaluating vaspin and adiponectin in postmenopausal women with endometrial cancer.
23850850 2013 Plasma vaspin concentrations are decreased in acute coronary syndrome, but unchanged in patients without coronary lesions.
23756768 2013 Analysis of a rare functional truncating mutation rs61757459 in vaspin (SERPINA12) on circulating vaspin levels.
23594688 2014 Investigation of vaspin level in patients with acute ischemic stroke.
23490415 2013 Adipokines vaspin and omentin-1 are up-regulated in large for gestational age infants at term.
23474107 2013 Circulating levels of novel adipocytokines in patients with colorectal cancer.
23466514 2013 Insulin administration acutely decreases vaspin serum concentrations in humans.
23370777 2013 Vaspin inhibits kallikrein 7 by serpin mechanism.
23359189 2012 Serum vaspin may be a good indicator of fibrosis in chronic hepatitis C and is not altered by antiviral therapy.
23342091 2013 Role of vaspin in human eating behaviour.
23318644 2013 Elevated vaspin and leptin levels are associated with obesity in prepubertal Korean children.
23307819 2013 Visceral adipose tissue-derived serine proteinase inhibitor inhibits apoptosis of endothelial cells as a ligand for the cell-surface GRP78/voltage-dependent anion channel complex.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23225237 2013 Gender-dependent effects of metformin on vaspin and adiponectin in type 2 diabetes patients: a randomized clinical trial.
23206815 2012 The serum vaspin levels are reduced in Japanese chronic hemodialysis patients.
23206449 2012 Vaspin serum concentration in patients with type 2 diabetes and carotid plaque.
23160181 2013 Novel common and rare genetic determinants of paraoxonase activity: FTO, SERPINA12, and ITGAL.
23135225 2013 Vaspin attenuates the apoptosis of human osteoblasts through ERK signaling pathway.
23123830 2013 Association of vaspin gene polymorphisms with coronary artery disease in Chinese population and function study.
23041430 2013 Serum vaspin levels in women with and without gestational diabetes mellitus during pregnancy and postpartum.
22982016 2012 Association between chemerin rs17173608 and vaspin rs2236242 gene polymorphisms and the metabolic syndrome, a preliminary report.
22907691 2013 Genetic variation in the vaspin gene affects circulating serum vaspin concentrations.
22539588 2012 Serum vaspin concentrations are closely related to insulin resistance, and rs77060950 at SERPINA12 genetically defines distinct group with higher serum levels in Japanese population.
22417310 2012 Vaspin--a link of obesity and psoriasis?
22246907 2011 Association between hepatic angiogenesis and serum adipokine profile in non-obese chronic hepatitis C patients.
22116078 2012 Impact of circulating vaspin levels on metabolic variables in elderly twins.
22032341 Circulating levels of the adipokines vaspin and omentin in patients with juvenile idiopathic arthritis, and relation to disease activity.
21893030 2011 Vaspin protects vascular endothelial cells against free fatty acid-induced apoptosis through a phosphatidylinositol 3-kinase/Akt pathway.
21798959 2011 Serum vaspin levels in hypothyroid patients.
21738955 2011 Potential role of leptin, adiponectin and three novel adipokines--visfatin, chemerin and vaspin--in chronic hepatitis.
21646731 2011 Relationship between vaspin gene expression and abdominal fat distribution of Korean women.
21545478 2011 Plasma vaspin concentrations are elevated in metabolic syndrome in men and are correlated with coronary atherosclerosis in women.
21513939 2011 Circulating vaspin levels and epicardial adipose tissue thickness are associated with impaired coronary flow reserve in patients with nonalcoholic fatty liver disease.
21442174 2012 Circulating levels of the adipocytokines vaspin and omentin in patients with Kawasaki disease.
20975299 2010 Serum vaspin concentrations are decreased after exercise-induced oxidative stress.
20850423 2011 Serum levels of vaspin and visfatin in patients with coronary artery disease-Kozani study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626239 2011 Serum vaspin and C-reactive protein levels in women with polycystic ovaries and polycystic ovary syndrome.
20605615 2011 Vaspin and visfatin/Nampt are interesting interrelated adipokines playing a role in the pathogenesis of type 2 diabetes mellitus.
20580037 2011 Serum levels of vaspin, obestatin, and apelin-36 in patients with nonalcoholic fatty liver disease.
20488498 2011 Omentin-1 and vaspin are present in the fetus and neonate, and perinatal concentrations are similar in normal and growth-restricted pregnancies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20156923 2010 Circadian rhythm of serum vaspin in healthy male volunteers: relation to meals.
20095887 2010 Serum chemerin and vaspin in non-alcoholic fatty liver disease.
20060144 2010 Association between serum vaspin concentrations and visceral adipose tissue in Korean subjects.
20045145 2010 Preliminary report: circulating levels of the adipokine vaspin in gestational diabetes mellitus and preeclampsia.
20018186 2010 Reduced serum vaspin concentrations in obese children following short-term intensive lifestyle modification.
19952124 2010 Circulating vaspin is unrelated to insulin sensitivity in a cohort of nondiabetic humans.
19951565 2009 Serum vaspin level in relation to postprandial plasma glucose concentration in subjects with diabetes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19816707 2010 Combined effects of body mass index and cardio/respiratory fitness on serum vaspin concentrations in Korean young men.
19554505 2009 Vaspin and amylin are expressed in human and rat placenta and regulated by nutritional status.
19356820 2009 Vaspin and its correlation with insulin sensitivity indices in obese children.
19114623 2009 Serum visceral adipose tissue-derived serine protease inhibitor concentrations in human obesity and polycystic ovary syndrome.
18848328 2009 Vaspin serum concentrations in patients with carotid stenosis.
18800627 2008 [Vaspin and insulin resistance].
18726871 2010 Vaspin (SERPINA12) genotypes and risk of type 2 diabetes: Results from the MONICA/KORA studies.
18375437 2008 Metformin decreases the adipokine vaspin in overweight women with polycystic ovary syndrome concomitant with improvement in insulin sensitivity and a decrease in insulin resistance.
17991760 2008 Serum vaspin concentrations in human obesity and type 2 diabetes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16298335 2006 Vaspin gene expression in human adipose tissue: association with obesity and type 2 diabetes.
16030142 2005 Visceral adipose tissue-derived serine protease inhibitor: a unique insulin-sensitizing adipocytokine in obesity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.