Property Summary

NCBI Gene PubMed Count 40
PubMed Score 67.99
PubTator Score 52.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.798 3.8e-02
diabetes mellitus 1.100 1.7e-03
ovarian cancer -1.300 5.0e-06

Gene RIF (28)

PMID Text
26982741 rs2232710 SNV showed no association with DVT in two Dutch replication cohorts the LETS study and the MEGA study, indicating that the rs2232710 variant is not a risk factor for DVT
25713144 Results show the energetic basis of the Z-dependent protease inhibitor (ZPI)-protein Z (PZ) interaction and suggest an important role for ZPI Lys-239 in PZ catalytic action.
24960590 Protein Z EGF2 subdomain constitutes an interactive-site for ZPI protein.
24315319 The unbalance between PZ and ZPI in plasma samples from patients with Colorectal Cancer or Pancreatic Cancer is not only related to an inflammatory state but could also results from an ectopic synthesis of these proteins by the cancer cells.
24158387 Protein Z/protein Z-dependent protease inhibitor and Fxa expression in human gastric cancer cells indicate that these proteins may play a role in anticoagulant events at the tumor tissue.
23530052 structural features within residues of the 39-loop contribute to the resistance of FIXa to inhibition by plasma inhibitors ZPI and TFPI.
23269381 the PZ/ZPI complex may play some modulating role in hemophilia A
22786881 The study shows by Ala-scanning mutagenesis of the ZPI-binding interface, together with native PAGE and kinetic analyses of PZ binding to ZPI, that Tyr240 and Asp293 of ZPI are crucial hot spots for PZ binding.
22540147 heparin-binding site of ZPI was mapped: basic residues of both helices C and D of ZPI interact with heparin to modulate the inhibitory function of the serpin.
22424030 localization of PZ/ZPI and FX in colon cancer cells indicates that PZ/ZPI may contribute to anticoagulant events at the tumor site.
22399118 Report two missense mutations identified in venous thrombosis patients impair the inhibitory function of the ZPI were not convincingly associted with thrombosis risk.
22274138 Plasma ZPI levels were unchanged in non-pregnant recurrent miscarriage women, while the plasma PZ level was slightly reduced, a finding consistent with existing reports.
22039093 The results demonstrate that both ZPI R67X and W303X non-sense variants and specific ZPI haplotypes are significantly associated with recurrent spontaneous miscarriage.
21975032 Medium expression of ZPI(IRS=6.5), together with weak expression of PZ(IRS=4), was observed in cancer cells.
21220417 heparin activates ZPI to inhibit free factor Xa as well as factor XIa and therefore may play a physiologically and pharmacologically important role in ZPI anticoagulant function.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20458435 present in loco in human breast cancer tissue
20427285 Data show that mutation of four ZPI contact residues eliminated PZ binding and membrane-dependent PZ acceleration of fXa inhibition.
20024489 PROTEIN A AND PZI WERE FOUND IN KIDNEY TUBULES BY IMMUNOHISTOCHEMISTRY
19913121 Observational study of gene-disease association. (HuGE Navigator)
19172319 Data show that the structural model of ZPI/FXa is compatible with available experimental information regarding the importance for the inhibitory action of certain basic residues in FXa.
18768472 ZPI functions like other serpins to regulate the activity of FXa but in a manner uniquely dependent on protein Z, procoagulant membranes, and pH
18710385 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17582153 a new R67Q mutation is found
16527896 Observational study of gene-disease association. (HuGE Navigator)
16527896 Our study supports that the ZPI Arg67Stop nonsense polymorphism might be an independent genetic risk factor for venous thrombosis. This polymorphism has slightly lower prevalence but similar thrombotic risk than the FV Leiden or prothrombin 20210A.
16093243 protein Z-dependent protease inhibitor may be an unusual physiologic regulator of both the intrinsic factor x-ase and the prothrombinase complexes.
16079143 the catalytic residue of fXa is required for interaction with ZPI

AA Sequence

MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMA      1 - 70
SRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGL     71 - 140
LPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYIN    141 - 210
KETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFD    211 - 280
KNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHE    281 - 350
LLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPF    351 - 420
HFMIYEETSGMLLFLGRVVNPTLL                                                  421 - 444
//

Text Mined References (44)

PMID Year Title
26982741 2016 Single Nucleotide Variant rs2232710 in the Protein Z-Dependent Protease Inhibitor (ZPI, SERPINA10) Gene Is Not Associated with Deep Vein Thrombosis.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25713144 2015 Thermodynamic and kinetic characterization of the protein Z-dependent protease inhibitor (ZPI)-protein Z interaction reveals an unexpected role for ZPI Lys-239.
24960590 2014 Characterization of the protein Z-dependent protease inhibitor interactive-sites of protein Z.
24315319 2014 Unbalance between plasma levels of Protein Z and protein Z-dependent inhibitor in patients with colorectal and pancreatic cancer: a pilot study.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24158387 2014 Protein Z/protein Z-dependent protease inhibitor system in loco in human gastric cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23530052 2013 Residues of the 39-loop restrict the plasma inhibitor specificity of factor IXa.
23375655 2013 Identification of mutations in SLC24A4, encoding a potassium-dependent sodium/calcium exchanger, as a cause of amelogenesis imperfecta.
23269381 2013 Plasma concentration of protein Z and protein Z-dependent protease inhibitor in patients with haemophilia A.
22786881 2012 Structural basis for catalytic activation of protein Z-dependent protease inhibitor (ZPI) by protein Z.
22540147 2012 Characterization of the heparin-binding site of the protein z-dependent protease inhibitor.
22424030 2012 Co-localization of Protein Z, Protein Z-Dependent protease inhibitor and coagulation factor X in human colon cancer tissue: implications for coagulation regulation on tumor cells.
22399118 2012 Two missense mutations identified in venous thrombosis patients impair the inhibitory function of the protein Z dependent protease inhibitor.
22274138 2012 Increase in the plasma levels of protein Z-dependent protease inhibitor in normal pregnancies but not in non-pregnant patients with unexplained recurrent miscarriage.
22039093 2012 Association of the R67X and W303X non-sense polymorphisms in the protein Z-dependent protease inhibitor gene with idiopathic recurrent miscarriage.
21975032 2012 Protein Z/protein Z-dependent protease inhibitor system in human non-small-cell lung cancer tissue.
21220417 2011 Heparin is a major activator of the anticoagulant serpin, protein Z-dependent protease inhibitor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458435 2010 Protein Z-dependent protease inhibitor (ZPI) is present in loco in human breast cancer tissue.
20427285 2010 Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa.
20024489 2010 Protein Z and protein Z-dependent protease inhibitor and renal tubules.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19528533 2009 Crystal structure of protein Z-dependent inhibitor complex shows how protein Z functions as a cofactor in the membrane inhibition of factor X.
19172319 2009 A computational modeling and molecular dynamics study of the Michaelis complex of human protein Z-dependent protease inhibitor (ZPI) and factor Xa (FXa).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18768472 2008 Kinetic characterization of the protein Z-dependent protease inhibitor reaction with blood coagulation factor Xa.
18710385 2008 Polymorphisms of the Z protein protease inhibitor and risk of venous thromboembolism: a meta-analysis.
17582153 2007 Hybridization probe genotyping of the R67X nonsense polymorphism in the protein Z-dependent protease inhibitor reveals a new R67Q mutation.
16527896 2006 A nonsense polymorphism in the protein Z-dependent protease inhibitor increases the risk for venous thrombosis.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16093243 2005 Down-regulation of factor IXa in the factor Xase complex by protein Z-dependent protease inhibitor.
16079143 2005 Identification of factor Xa residues critical for interaction with protein Z-dependent protease inhibitor: both active site and exosite interactions are required for inhibition.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461625 2004 Mutations within the protein Z-dependent protease inhibitor gene are associated with venous thromboembolic disease: a new form of thrombophilia.
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11751269 2002 A role for the human sperm glycine receptor/Cl(-) channel in the acrosome reaction initiated by recombinant ZP3.
11049983 2000 Characterization of the protein Z-dependent protease inhibitor.
10829076 2000 Prothrombotic phenotype of protein Z deficiency.
10460162 1999 The protein Z-dependent protease inhibitor is a serpin.
9689066 1998 Isolation of a protein Z-dependent plasma protease inhibitor.