Property Summary

NCBI Gene PubMed Count 508
PubMed Score 5601.82
PubTator Score 2342.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Vascular disease 319 4.084 2.0

Expression

  Differential Expression (32)

Disease log2 FC p
cystic fibrosis 1.592 3.6e-04
active Crohn's disease 2.546 1.2e-02
active ulcerative colitis 2.682 3.5e-04
adult high grade glioma 1.500 1.9e-02
Astrocytoma, Pilocytic 1.900 7.3e-06
atypical teratoid / rhabdoid tumor 1.400 3.5e-03
Barrett's esophagus 3.700 1.4e-02
breast carcinoma 1.500 7.6e-03
chronic lymphosyte leukemia -2.600 1.3e-11
cutaneous lupus erythematosus 1.800 1.8e-02
ependymoma 1.200 1.7e-02
esophageal adenocarcinoma 3.800 1.8e-02
fibroadenoma 1.900 2.3e-03
gastric carcinoma 3.000 3.7e-02
glioblastoma 1.300 9.9e-03
group 3 medulloblastoma -1.500 4.9e-02
head and neck cancer and chronic obstruc... 1.800 5.6e-03
interstitial cystitis 3.700 4.8e-04
invasive ductal carcinoma 1.171 4.1e-03
lung cancer -6.600 2.1e-08
lung carcinoma -3.000 1.7e-15
medulloblastoma, large-cell 2.000 4.6e-06
mucosa-associated lymphoid tissue lympho... 2.783 5.9e-03
nephrosclerosis -1.114 4.0e-02
non-small cell lung cancer -2.035 6.0e-08
osteosarcoma -2.869 1.5e-02
ovarian cancer 1.600 5.9e-11
pancreatic cancer 1.400 3.2e-03
pancreatic ductal adenocarcinoma liver m... -2.822 6.7e-03
periodontitis 1.300 3.7e-28
psoriasis 1.600 1.0e-05
tuberculosis 1.400 4.0e-07

PDB (26)

Gene RIF (416)

AA Sequence

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN      1 - 70
STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN     71 - 140
GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN    141 - 210
YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD    211 - 280
EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP    281 - 350
LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK      351 - 418
//

Text Mined References (518)

PMID Year Title