Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.85
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 1.6e-02
ependymoma -1.700 2.7e-02
glioblastoma -1.900 6.9e-06
group 3 medulloblastoma -2.500 1.0e-05
atypical teratoid / rhabdoid tumor -1.700 3.4e-07
medulloblastoma, large-cell -2.400 7.6e-04
pediatric high grade glioma -1.700 2.0e-06
subependymal giant cell astrocytoma -1.539 2.4e-02

AA Sequence

MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGM           1 - 65
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.