Property Summary

NCBI Gene PubMed Count 15
PubMed Score 264.28
PubTator Score 24.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.096 5.7e-04
adult high grade glioma -1.200 1.3e-03
astrocytic glioma -1.200 1.8e-02
atypical teratoid / rhabdoid tumor -1.800 9.1e-06
glioblastoma -1.300 1.4e-04
group 3 medulloblastoma -1.600 5.0e-04
lung adenocarcinoma -1.100 3.0e-07
medulloblastoma, large-cell -1.300 1.1e-04
Multiple myeloma 1.096 6.6e-03
osteosarcoma -1.302 3.6e-04
ovarian cancer -1.800 2.3e-06
primitive neuroectodermal tumor -1.300 3.4e-04
psoriasis -1.300 2.0e-04
Rheumatoid arthritis 1.400 9.3e-03
tuberculosis and treatment for 3 months -1.100 3.7e-03

Gene RIF (7)

AA Sequence

MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPG      1 - 70
FCEGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAA     71 - 140
LIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFT    141 - 210
SAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTM    211 - 280
YLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLY    281 - 350
SSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIM    351 - 420
MTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS                     421 - 473
//

Text Mined References (16)

PMID Year Title