Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.97
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.7e-05
ductal carcinoma in situ 1745 4.1e-02
inflammatory breast cancer 286 5.0e-02
Disease Target Count Z-score Confidence
Cervical squamous cell carcinoma 10 3.359 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
ductal carcinoma in situ 2.000 4.1e-02
inflammatory breast cancer -2.200 5.0e-02
psoriasis -1.400 4.7e-05

Gene RIF (1)

AA Sequence

MSENAAPGLISELKLAVPWGHIAAKAWGSLQGPPVLCLHGWLDNASSFDRLIPLLPQDFYYVAMDFGGHG      1 - 70
LSSHYSPGVPYYLQTFVSEIRRVVAALKWNRFSILGHSFGGVVGGMFFCTFPEMVDKLILLDTPLFLLES     71 - 140
DEMENLLTYKRRAIEHVLQVEASQEPSHVFSLKQLLQRLLKSNSHLSEECGELLLQRGTTKVATGLVLNR    141 - 210
DQRLAWAENSIDFISRELCAHSIRKLQAHVLLIKAVHGYFDSRQNYSEKESLSFMIDTMKSTLKEQFQFV    211 - 280
EVPGNHCVHMSEPQHVASIISSFLQCTHMLPAQL                                        281 - 314
//

Text Mined References (8)

PMID Year Title