Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.97
PubTator Score 0.07

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 4.7e-05
ductal carcinoma in situ 1745 4.1e-02
inflammatory breast cancer 404 5.0e-02


  Differential Expression (3)

Disease log2 FC p
psoriasis -1.400 4.7e-05
inflammatory breast cancer -2.200 5.0e-02
ductal carcinoma in situ 2.000 4.1e-02

Gene RIF (1)

20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

EVPGNHCVHMSEPQHVASIISSFLQCTHMLPAQL                                        281 - 314

Text Mined References (8)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11352564 2001 Identification of Serhl, a new member of the serine hydrolase family induced by passive stretch of skeletal muscle in vivo.
11181995 2001 The sequence of the human genome.
10591208 1999 The DNA sequence of human chromosome 22.