Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.60
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK                 1 - 59
//

Text Mined References (15)

PMID Year Title