Property Summary

NCBI Gene PubMed Count 47
PubMed Score 117.49
PubTator Score 54.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.906 1.4e-03
Multiple myeloma 1.710 4.2e-04
astrocytic glioma -1.700 3.2e-03
ependymoma -2.200 5.9e-03
oligodendroglioma -1.700 8.7e-03
cutaneous lupus erythematosus -1.300 4.9e-04
psoriasis -1.500 8.2e-04
glioblastoma -2.400 1.8e-06
osteosarcoma -1.362 8.0e-03
medulloblastoma -1.800 1.2e-06
atypical teratoid / rhabdoid tumor -2.400 2.0e-08
medulloblastoma, large-cell -2.300 8.0e-06
primitive neuroectodermal tumor -1.200 3.0e-03
primary pancreatic ductal adenocarcinoma 1.417 1.1e-03
pediatric high grade glioma -1.700 2.9e-05
subependymal giant cell astrocytoma -1.520 1.6e-02
Alzheimer's disease -1.100 3.5e-02
Pick disease -1.400 1.3e-04
progressive supranuclear palsy -1.100 4.2e-02
ovarian cancer -1.800 7.3e-09

Gene RIF (26)

PMID Text
25380047 Septin6 and Septin7 GTP binding proteins regulate AP-3- and ESCRT-dependent multivesicular body biogenesis
24685401 Significantly lower SEPT7 expression in all expressional categories in encapsulated papillary thyroid carcinoma, follicular variant group may be a sign of different molecular signature in this type of tissue.
24685401 Significantly lower SEPT7 expression in encapsulated follicular variant of papillary thyroid carcinoma may be a sign of different molecular signature in this type of tissue.
24345743 In response to Candida albicans infection, SEPT7 forms a complex with endothelial cell N-cadherin, is required for normal accumulation of N-cadherin around hyphae, and is necessary for maximal fungal endocytosis.
24055994 Overexpression of the yeast septin7 ortholog CDC10 also conferred resistance to the negative effects of copper as well as protecting cells from the overexpression of Bax.
23572511 SEPT2 forms a 1:1:1 complex with SEPT7 and SEPT9.
23383034 miR-30a-5p is a bona fide negative regulator of SEPT7 and the oncogenic activity of miR-30a-5p in human gliomas is at least in part through the repression of SEPT7
22956766 Myeloid K562 cells express three SEPT9 isoforms, all of which have an equal propensity to hetero-oligomerize with SEPT7-containing hexamers to generate octameric heteromers.
22064074 the purification, crystallization and structure for the GTP-binding domain of human septin 7
21824007 Sept7 occupies the ends of hexameric building blocks which assemble into non-polarised filaments.
21788367 The SEPT7 provides the directional guidance cues necessary for polarizing the epithelial microtubule network.
21767235 Mutagenic analyses revealed that mutation of a potential phosphorylation site in SEPT7 (Y318) regulates the interaction with other septins.
21509594 SEPT7 gene expression is decreased in follicular variant of papillary thyroid carcinoma.
21082023 Data show that Septins of the SEPT6 group preferentially interacted with septins of the SEPT2 group, SEPT3 group and SEPT7 group.
20385374 The expression of SEPT7 mRNA was significantly decreased by 6.9% in subjects with schizophrenia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20352323 SEPT7 is involved in the regulation of sperm maturation.
20035367 This study demonstrates that SEPT7 is involved in gliomagenesis and suppresses glioma cell growth.
19916744 SEPT7 plays an important role in the glioma cell invasion.
19426592 regulated but the expression of CDK9, CDC20 and CLK3 was down- regulated in azoospermic testes.
18543212 SEPT7 gene can inhibit the invasion and migration ability of U251 glioma cells by reversing imbalanced state of MMPs/TIMPs, downregulating expression of integrin alpha(v)beta(3) and altering structure of tubulin-alpha.
18460473 SEPT7 forms a link between kinetochore distribution of CENP-E and the mitotic spindle checkpoint.
17803907 Demonstrate connection between septins/SOCS7/NCK signaling and the DNA damage response.
17637674 crystal structures of the human SEPT2 G domain and the heterotrimeric human SEPT2-SEPT6-SEPT7 complex
16914550 septin 2, 6, and 7 complexes make up polymerized filaments
15485874 Sept7/9b/11 form a complex that has effects on filament elongation, bundling, or disruption

AA Sequence

MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSL      1 - 70
FLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFED     71 - 140
YLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQ    141 - 210
IMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHC    211 - 280
DFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKM    281 - 350
KKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQ    351 - 420
QNSSRTLEKNKKKGKIF                                                         421 - 437
//

Text Mined References (57)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25588830 2015 SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25380047 2014 Septin6 and Septin7 GTP binding proteins regulate AP-3- and ESCRT-dependent multivesicular body biogenesis.
24685401 2014 Septin 7 immunoexpression in papillary thyroid carcinoma: a preliminary study.
24345743 2013 Role of endothelial cell septin 7 in the endocytosis of Candida albicans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24055994 2013 The human septin7 and the yeast CDC10 septin prevent Bax and copper mediated cell death in yeast.
23572511 2013 Septins 2, 7 and 9 and MAP4 colocalize along the axoneme in the primary cilium and control ciliary length.
23383034 2013 MiR-30a-5p antisense oligonucleotide suppresses glioma cell growth by targeting SEPT7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22956766 2012 Mammalian SEPT9 isoforms direct microtubule-dependent arrangements of septin core heteromers.
22064074 2011 Promiscuous interactions of human septins: the GTP binding domain of SEPT7 forms filaments within the crystal.
21824007 2011 Structural and biochemical properties of Sept7, a unique septin required for filament formation.
21788367 2011 Septin GTPases spatially guide microtubule organization and plus end dynamics in polarizing epithelia.
21767235 2011 Characterization of human septin interactions.
21616478 2011 Cyclin-dependent kinase 5 activator p25 is generated during memory formation and is reduced at an early stage in Alzheimer's disease.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21082023 2010 A draft of the human septin interactome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20385374 2010 Altered cortical CDC42 signaling pathways in schizophrenia: implications for dendritic spine deficits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20352323 2010 The expression pattern of SEPT7 correlates with sperm morphology.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20035367 2010 Overexpression of septin 7 suppresses glioma cell growth.
19916744 2010 Upregulation of SEPT7 gene inhibits invasion of human glioma cells.
19426592 2009 [Expression of cell cycle molecules in human azoospermic testes].
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19221096 2009 Absence of annulus in human asthenozoospermia: case report.
19145258 2009 Septins regulate bacterial entry into host cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18543212 2008 [Study on the anti-invasion effect of SEPT7 gene for U251MG glioma cell in vitro].
18460473 2008 Septin 7 interacts with centromere-associated protein E and is required for its kinetochore localization.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17803907 2007 Septins regulate actin organization and cell-cycle arrest through nuclear accumulation of NCK mediated by SOCS7.
17685441 2007 Sept12 is a component of the mammalian sperm tail annulus.
17637674 2007 Structural insight into filament formation by mammalian septins.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16914550 2006 Structural analysis of septin 2, 6, and 7 complexes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16093351 2005 Mammalian septins regulate microtubule stability through interaction with the microtubule-binding protein MAP4.
15915442 2005 Expression profiling the human septin gene family.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485874 2004 Biochemical and cell biological analyses of a mammalian septin complex, Sept7/9b/11.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14531065 Interaction of the S100A4 (Mts1) protein with septins Sept2, Sept6, and Sept7 in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388755 2002 The mammalian septin MSF localizes with microtubules and is required for completion of cytokinesis.
11584266 2001 Borg proteins control septin organization and are negatively regulated by Cdc42.
10931866 2000 Functional analysis of a human homologue of the Drosophila actin binding protein anillin suggests a role in cytokinesis.
9655500 1998 Subunit composition, protein interactions, and structures of the mammalian brain sec6/8 complex and septin filaments.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8037772 1994 Molecular cloning of a novel human cDNA homologous to CDC10 in Saccharomyces cerevisiae.