Property Summary

NCBI Gene PubMed Count 31
PubMed Score 90.94
PubTator Score 61.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.625 3.2e-02
malignant mesothelioma 2.800 3.8e-08
astrocytic glioma -2.500 1.2e-03
ependymoma -2.700 1.9e-03
oligodendroglioma -2.000 7.3e-03
cutaneous lupus erythematosus 1.600 8.3e-03
psoriasis -1.300 1.8e-04
glioblastoma -2.100 1.2e-05
osteosarcoma -3.003 1.4e-04
group 3 medulloblastoma 3.500 1.3e-07
periodontitis 1.100 5.3e-23
atypical teratoid / rhabdoid tumor 1.800 4.0e-04
medulloblastoma, large-cell 2.500 2.3e-06
primitive neuroectodermal tumor 1.800 4.5e-03
primary pancreatic ductal adenocarcinoma 2.108 1.3e-04
intraductal papillary-mucinous carcinoma... -1.800 5.2e-03
colon cancer -2.000 1.4e-02
lung cancer -2.300 1.6e-04
interstitial cystitis 2.100 9.3e-04
pediatric high grade glioma -2.000 3.0e-08
pilocytic astrocytoma 1.700 1.3e-05
primary Sjogren syndrome 2.100 1.2e-04
subependymal giant cell astrocytoma 1.598 3.3e-02
invasive ductal carcinoma 1.800 1.3e-03
Pick disease -1.300 1.2e-02
ductal carcinoma in situ 1.800 1.5e-03
ulcerative colitis 2.300 1.3e-05
ovarian cancer 1.500 1.6e-03
pancreatic cancer 1.600 1.8e-03

 GO Function (1)

Gene RIF (11)

PMID Text
25519054 MiR-223-3p might target gene SEPT6 and promoted the biological behavior of prostate cancer.
25380047 Septin6 and Septin7 GTP binding proteins regulate AP-3- and ESCRT-dependent multivesicular body biogenesis
21788367 The SEPT6 provides the directional guidance cues necessary for polarizing the epithelial microtubule network.
21082023 Data show that Septins of the SEPT6 group preferentially interacted with septins of the SEPT2 group, SEPT3 group and SEPT7 group.
18047794 co-expression of SEPT12 altered the filamentous structure of SEPT6 in Hela cells
17803907 Demonstrate connection between septins/SOCS7/NCK signaling and the DNA damage response.
17637674 crystal structures of the human SEPT2 G domain and the heterotrimeric human SEPT2-SEPT6-SEPT7 complex
17229681 These results indicate that the host proteins hnRNP A1 and septin 6 play important roles in the replication of HCV through RNA-protein and protein-protein interactions.
16914550 septin 2, 6, and 7 complexes make up polymerized filaments
16843108 Molecular analysis using rtPCR followed by sequencing confirmed the expression of an MLL-SEPT6 fusion transcript with a novel sequence.
12096348 MLL-SEPTIN6 fusion recurs in novel translocation of chromosomes 3, X, and 11 in infant acute myelomonocytic leukaemia and in t(X;11) in infant acute myeloid leukaemia

AA Sequence

MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGE      1 - 70
PATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL     71 - 140
HTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGV    141 - 210
QIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIR    211 - 280
VNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV    281 - 350
KEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLK    351 - 420
RDKEKKNNPWLCTE                                                            421 - 434
//

Text Mined References (42)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25775403 2015 SEPT12/SPAG4/LAMINB1 complexes are required for maintaining the integrity of the nuclear envelope in postmeiotic male germ cells.
25588830 2015 SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins.
25519054 2014 MiR-223-3p targeting SEPT6 promotes the biological behavior of prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25380047 2014 Septin6 and Septin7 GTP binding proteins regulate AP-3- and ESCRT-dependent multivesicular body biogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21788367 2011 Septin GTPases spatially guide microtubule organization and plus end dynamics in polarizing epithelia.
21269460 2011 Initial characterization of the human central proteome.
21082023 2010 A draft of the human septin interactome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19145258 2009 Septins regulate bacterial entry into host cells.
18047794 2007 SEPT12 interacts with SEPT6 and this interaction alters the filament structure of SEPT6 in Hela cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17803907 2007 Septins regulate actin organization and cell-cycle arrest through nuclear accumulation of NCK mediated by SOCS7.
17637674 2007 Structural insight into filament formation by mammalian septins.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17229681 2007 An RNA-binding protein, hnRNP A1, and a scaffold protein, septin 6, facilitate hepatitis C virus replication.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16914550 2006 Structural analysis of septin 2, 6, and 7 complexes.
16843108 2006 MLL-SEPT6 fusion transcript with a novel sequence in an infant with acute myeloid leukemia.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16093351 2005 Mammalian septins regulate microtubule stability through interaction with the microtubule-binding protein MAP4.
15915442 2005 Expression profiling the human septin gene family.
15774761 2005 A mitotic septin scaffold required for Mammalian chromosome congression and segregation.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14531065 Interaction of the S100A4 (Mts1) protein with septins Sept2, Sept6, and Sept7 in vitro.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12544826 2003 The septin protein Nedd5 associates with both the exocyst complex and microtubules and disruption of its GTPase activity promotes aberrant neurite sprouting in PC12 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446710 2003 Borg/septin interactions and the assembly of mammalian septin heterodimers, trimers, and filaments.
12388755 2002 The mammalian septin MSF localizes with microtubules and is required for completion of cytokinesis.
12096348 2002 MLL-SEPTIN6 fusion recurs in novel translocation of chromosomes 3, X, and 11 in infant acute myelomonocytic leukaemia and in t(X;11) in infant acute myeloid leukaemia, and MLL genomic breakpoint in complex MLL-SEPTIN6 rearrangement is a DNA topoisomerase II cleavage site.
11809673 2002 SEPTIN6, a human homologue to mouse Septin6, is fused to MLL in infant acute myeloid leukemia with complex chromosomal abnormalities involving 11q23 and Xq24.
11064363 2000 Differential localization of septins in the mouse brain.
10744683 2000 Phosphorylation of a new brain-specific septin, G-septin, by cGMP-dependent protein kinase.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.