Property Summary

NCBI Gene PubMed Count 32
PubMed Score 49.43
PubTator Score 91.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.900 4.3e-05
Amyotrophic lateral sclerosis -1.076 4.9e-04
Astrocytoma, Pilocytic -1.300 1.4e-04
atypical teratoid / rhabdoid tumor -1.100 6.0e-05
diabetes mellitus 2.300 1.1e-03
glioblastoma -1.200 2.0e-05
juvenile dermatomyositis -1.182 3.2e-08
medulloblastoma, large-cell -1.500 3.0e-05
non primary Sjogren syndrome sicca 1.300 1.3e-02
ovarian cancer -1.300 1.0e-04

Gene RIF (5)

AA Sequence

MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLY      1 - 70
KDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDE     71 - 140
SGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEI    141 - 210
DKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDF    211 - 280
VKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDE    281 - 350
ELRRMQEMLQRMKQQMQDQ                                                       351 - 369
//

Text Mined References (38)

PMID Year Title