Property Summary

NCBI Gene PubMed Count 45
PubMed Score 216.35
PubTator Score 603.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
nephrosclerosis 1.207 4.2e-05
astrocytic glioma -2.500 2.2e-02
psoriasis -1.500 2.0e-04
glioblastoma -2.800 4.8e-02
oligodendroglioma -1.600 4.4e-07
osteosarcoma -2.221 6.7e-04
ependymoma -2.500 2.4e-06
group 4 medulloblastoma -3.100 1.6e-05
atypical teratoid/rhabdoid tumor -4.500 3.6e-12
medulloblastoma, large-cell -3.100 1.8e-03
primitive neuroectodermal tumor -2.500 6.0e-03
adrenocortical carcinoma -2.629 3.5e-04
non-small cell lung cancer -1.601 1.7e-20
intraductal papillary-mucinous adenoma (... -1.100 6.0e-04
intraductal papillary-mucinous carcinoma... -1.200 7.4e-04
intraductal papillary-mucinous neoplasm ... -1.300 4.0e-03
lung cancer -2.000 2.5e-04
interstitial cystitis 1.400 3.5e-04
adult high grade glioma -3.200 1.3e-04
pilocytic astrocytoma -1.700 2.6e-04
subependymal giant cell astrocytoma -4.480 3.4e-03
lung adenocarcinoma -1.055 2.6e-08
Pick disease -1.500 9.7e-05
progressive supranuclear palsy -1.200 2.0e-02
invasive ductal carcinoma -1.500 1.3e-03

Gene RIF (28)

PMID Text
25527525 The data suggest that Sept4_i1 induces hepatic stellate cell apoptosis by inhibiting Akt and Bcl-2 expression and up-regulating PPAR-gamma expression.
23479728 Identification of a novel anti-apoptotic E3 ubiquitin ligase that ubiquitinates antagonists of inhibitor of apoptosis proteins SMAC, HtrA2, and ARTS.
23180367 results suggest that Septin4 may be involved in the process of activation of hepatic stellate cells by lipopolysaccharide stimulation.
22503047 Bradeion/SEPT4 transcript levels are significantly increased in patients with transitional cell bladder cancer.We hypothesize that Bradeion is directly involved in bladder cancer pathogenesis with the highest expression at early cancer stages.
21952823 these data suggests a tumor suppressor role of SEPT4_i1 in HCC through regulating hepatocellular carcinoma cell apoptosis.
21938432 SEPT4 is a Notch target gene.
21898991 The expression of SEPT4 is significantly decreased in the ejaculated sperm of idiopathic asthenozoospermia patients.
21824006 ARTS is localized at mitochondria and promotes programmed cell death (apoptosis).
20877624 Observational study of gene-disease association. (HuGE Navigator)
19221096 structural defects in sperm are not caused by abnormal transcription or point mutations of the TAT1 and SEPT4 genes; however, although both proteins are expressed, they are not properly localized at sperm annulus
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18951507 Sporadic PD cases showed a statistically significant decrease of the fold change (FC) of SEPT4 (FC = 0.67, P = 0.054) gene expressions in the substantia nigra & amygdala (SEPT4: FC = 0.32, P = 0.007) versus healthy controls.
18617022 The stability and aggregation properties of the GTPase domain from human SEPT4.
17764158 Data report an intermediate structure of the GTPase domain of human SEPT4 (SEPT4-G) during unfolding transitions induced by temperature.
17644312 This protein may play an important role in the pathogenesis of schizophrenia and could be used as a marker for this disease.
17546647 SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling
17383018 interaction of kaposin A protein and the septin 4 variant was suggested as playing a possible role in the development of HHV-8-associated malignancies
17296554 The Sept4 may be involved in PD as a dual susceptibility factor, as its insufficiency can diminish dopaminergic neurotransmission and enhance alpha-synuclein neurotoxicity.
17105210 define explicitly and characterize the domains of human SEPT4
16464805 Finds somatic mutation in P-loop domains of proapoptotic ARTS genes uncommon in colon cancers.
16376484 The data presented here suggest that ARTS P-loop is not frequently mutated in gastric, lung, and hepatocellular carcinomas, and that apoptosis deregulation in cancers is not dependent on the mutation of ARTS gene.
15837787 high cellular levels of ARTS protein sensitize cells toward apoptosis
15214843 We studied the assembly of three human septins, SEPT4, SEPT5 and SEPT8, with each other (heterotypic) and with themselves (homotypic) using a yeast two-hybrid system.
15122323 ARTS can function as a tumor suppressor protein in childhood acute lymphocytic leukemia.
15116257 SEPT8 and SEPT4 are localized surrounding alpha-granules. Activation of platelets by agonists resulted in the translocation of SEPT4 and SEPT8 to the platelet surface indicating a possible functional role of these proteins in platelet granular secretion
15029247 Data suggest that ARTS induces apoptosis by antagonizing IAPs, including XIAP.
12695511 Sept4 is involved in the formation of cytoplasmic inclusions as well as induction of cell death in alpha-synuclein-associated neurodegenerative disorders.
12032658 role of Bradeion in colorectal neoplasms

AA Sequence

MDRSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPD      1 - 70
LYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVK     71 - 140
KGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTP    141 - 210
GFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQ    211 - 280
RVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSN    281 - 350
TVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVV    351 - 420
KERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKENY                421 - 478
//

Text Mined References (48)

PMID Year Title
25588830 2015 SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins.
25527525 2015 Septin4_i1 regulates apoptosis in hepatic stellate cells through peroxisome proliferator-activated receptor-?/Akt/B-cell lymphoma 2 pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23479728 2013 Identification of a novel anti-apoptotic E3 ubiquitin ligase that ubiquitinates antagonists of inhibitor of apoptosis proteins SMAC, HtrA2, and ARTS.
23180367 2013 Expression of Septin4 in human hepatic stellate cells LX-2 stimulated by LPS.
22503047 2012 Bradeion (SEPT4) as a urinary marker of transitional cell bladder cancer: a real-time polymerase chain reaction study of gene expression.
21952823 2012 Involvement of SEPT4_i1 in hepatocellular carcinoma: SEPT4_i1 regulates susceptibility to apoptosis in hepatocellular carcinoma cells.
21938432 2012 SEPT4 is regulated by the Notch signaling pathway.
21898991 2011 [Expression of SEPT4 protein in the ejaculated sperm of idiopathic asthenozoospermic men].
21824006 2011 ARTS, the unusual septin: structural and functional aspects.
21185211 2011 ARTS and Siah collaborate in a pathway for XIAP degradation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19221096 2009 Absence of annulus in human asthenozoospermia: case report.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18951507 2009 Expression of Lewy body protein septin 4 in postmortem brain of Parkinson's disease and control subjects.
18617022 2008 The stability and aggregation properties of the GTPase domain from human SEPT4.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17764158 2007 An intermediate structure in the thermal unfolding of the GTPase domain of human septin 4 (SEPT4/Bradeion-beta) forms amyloid-like filaments in vitro.
17685441 2007 Sept12 is a component of the mammalian sperm tail annulus.
17644312 2007 The pro-apoptotic ARTS/Sept4 protein is significantly reduced in post-mortem brains from schizophrenic patients.
17546647 2007 SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling.
17383018 2007 Identification of a novel septin 4 protein binding to human herpesvirus 8 kaposin A protein using a phage display cDNA library.
17296554 2007 Sept4, a component of presynaptic scaffold and Lewy bodies, is required for the suppression of alpha-synuclein neurotoxicity.
17105210 2006 Dissection of a human septin: definition and characterization of distinct domains within human SEPT4.
16464805 2006 Mutational analysis of P-loop domains of proapoptotic Nod1 and ARTS genes in colon carcinomas.
16376484 2006 Mutational analysis of proapoptotic ARTS P-loop domain in common human cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15915442 2005 Expression profiling the human septin gene family.
15837787 2005 Regulation of the proapoptotic ARTS protein by ubiquitin-mediated degradation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254396 2004 The ARTS connection: role of ARTS in apoptosis and cancer.
15214843 2004 Human septin-septin interactions as a prerequisite for targeting septin complexes in the cytosol.
15122323 2004 Mitochondrial pro-apoptotic ARTS protein is lost in the majority of acute lymphoblastic leukemia patients.
15116257 2004 The novel human platelet septin SEPT8 is an interaction partner of SEPT4.
15029247 2004 The mitochondrial ARTS protein promotes apoptosis through targeting XIAP.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559152 2003 SEPT5_v2 is a parkin-binding protein.
12695511 2003 Association of the cytoskeletal GTP-binding protein Sept4/H5 with cytoplasmic inclusions found in Parkinson's disease and other synucleinopathies.
12544826 2003 The septin protein Nedd5 associates with both the exocyst complex and microtubules and disruption of its GTPase activity promotes aberrant neurite sprouting in PC12 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032658 2002 Impaired expression of a human septin family gene Bradeion inhibits the growth and tumorigenesis of colorectal cancer in vitro and in vivo.
11511094 2001 Characterization of tissue- and cell-type-specific expression of a novel human septin family gene, Bradeion.
11167005 2000 Characterization and expression analysis of two human septin genes, PNUTL1 and PNUTL2.
11146656 2000 A novel mitochondrial septin-like protein, ARTS, mediates apoptosis dependent on its P-loop motif.
10340703 1999 Characterization of the mammalian septin H5: distinct patterns of cytoskeletal and membrane association from other septin proteins.
9889007 1999 Characterization of a novel gene, PNUTL2, on human chromosome 17q22-q23 and its exclusion as the Meckel syndrome gene.