Property Summary

NCBI Gene PubMed Count 20
PubMed Score 96.69
PubTator Score 75.44

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 8.1e-03
astrocytoma -1.100 4.5e-10
Astrocytoma, Pilocytic -1.500 1.0e-06
atypical teratoid / rhabdoid tumor -1.700 6.1e-03
ependymoma -1.600 1.5e-08
glioblastoma -1.700 7.6e-05
group 3 medulloblastoma -1.300 8.0e-03
lung carcinoma 1.600 1.1e-13
medulloblastoma, large-cell -1.200 8.3e-04
pituitary cancer 1.600 2.5e-04

Gene RIF (5)

AA Sequence

MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQS      1 - 70
GLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWE     71 - 140
PIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKAD    141 - 210
TMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGR    211 - 280
KTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVP    281 - 350
ATPCPTAE                                                                  351 - 358
//

Text Mined References (24)

PMID Year Title