Property Summary

NCBI Gene PubMed Count 63
PubMed Score 175.29
PubTator Score 55.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.400 3.5e-02
Multiple myeloma 1.245 7.8e-03
astrocytic glioma 1.500 2.8e-02
ependymoma 1.900 2.9e-02
oligodendroglioma 2.000 1.3e-02
psoriasis 1.200 1.2e-03
glioblastoma 1.600 1.1e-04
osteosarcoma 2.007 9.2e-06
non diabetic and post-ischemic heart fai... -1.200 1.7e-02
atypical teratoid / rhabdoid tumor 1.900 2.8e-05
medulloblastoma 1.300 2.3e-02
medulloblastoma, large-cell 1.900 2.1e-04
primitive neuroectodermal tumor 1.100 1.6e-05
hereditary spastic paraplegia -1.295 3.8e-03
pancreatic ductal adenocarcinoma liver m... 1.146 3.5e-02
diabetes mellitus -2.400 1.3e-03
pediatric high grade glioma 1.300 3.8e-04
pilocytic astrocytoma 1.100 1.4e-03
lung adenocarcinoma 1.555 6.7e-11
Alzheimer's disease -1.100 3.9e-02
progressive supranuclear palsy -1.200 4.6e-03
Subcutaneous panniculitis-like T-cell ly... -1.200 3.8e-02
ovarian cancer 2.400 1.7e-04
Down syndrome 1.400 1.3e-03

Gene RIF (29)

PMID Text
26780475 From the nucleotide-free structure some interesting conclusions about the nucleotide binding properties of Cdc11 can be drawn; especially when aligning the structure with the structure of GDP bound Sept2
26000982 These results suggest that SEPTIN2-mediated cytoskeletal rearrangement and STATHMIN-mediated differentiation may contribute to changes in cell morphology and differentiation of H/RS cells with CD99 upregulation in Hodgkin lymphoma.
25592041 Suggest PPAR-gamma activation down-regulates hepatocellular carcinoma cell SEPT2 levels to prevent tumor growth.
25293760 Authors report here that the septins SEPT2, -9, -11, and probably -7 form fibrillar structures around the chlamydial inclusion.
24787956 Data indicate that forchlorfenuron (FCF) exhibits differential binding preference for septins SEPT2 and SEPT3.
23572511 SEPT2 forms a 1:1:1 complex with SEPT7 and SEPT9.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21967827 The results shown in study support the hypothesis that single Septin 2, when present in excess or with unbalanced stoichiometries, may be unstable and assemble into amyloid-like structures.
21788367 The SEPT2 provides the directional guidance cues necessary for polarizing the epithelial microtubule network.
21767235 Data illustrated roles of SEPT9 that might contribute to hetero-trimeric septin complex formation. SEPT9 can substitute for septins of the SEPT2 group and partially for SEPT7.
21504731 the role of SEPT2 and SEPT11 in the InlB-Met interactions
21082023 Data show that Septins of the SEPT6 group preferentially interacted with septins of the SEPT2 group, SEPT3 group and SEPT7 group.
20870893 septin-2 plays a fundamental role in regulating barrier function by altering cortical actin expression.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19234302 SEPT2 is essential for the InlB-mediated entry of Listeria, but SEPT11 is not, which distinguishes the roles of different mammalian septins
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165576 confirmed that the phosphorylation of SEPT2 on Ser218 by CK2 was crucial to the proliferation of HCC. These results suggest that SEPT2 might be a promising target for liver cancer therapy
18676680 Observational study of gene-disease association. (HuGE Navigator)
18656699 A novel MLL-SEPT2 fusion variant in therapy-related myelodysplastic syndrome is reported.
18209106 Study shows that in epithelial cells septin 2 fibers colocalize with a subset of microtubule tracks composed of polyglutamylated tubulin.
17803907 Demonstrate connection between septins/SOCS7/NCK signaling and the DNA damage response.
17637674 crystal structures of the human SEPT2 G domain and the heterotrimeric human SEPT2-SEPT6-SEPT7 complex
16914550 septin 2, 6, and 7 complexes make up polymerized filaments
16682951 protein encoded by SEPT2 is highly homologous to septins 1, 4 and 5 and is involved in the coordination of several key steps of mitosis
15987492 Nedd5 C-terminal is a novel autoantigen in systemic lupus erythematosus (SLE) patients and may be a valuable tool for diagnosing neuropsychiatric SLE.
15774761 septins may form a mitotic scaffold for CENP-E and other effectors to coordinate cytokinesis with chromosome congression and segregation
12125979 Nedd5 is involved in the process of cytokinesis in human brain tumours.

AA Sequence

MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPG      1 - 70
AAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH     71 - 140
IIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI    141 - 210
YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML    211 - 280
ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG    281 - 350
DGDGGALGHHV                                                               351 - 361
//

Text Mined References (83)

PMID Year Title
26780475 2016 Crystal structure of Cdc11, a septin subunit from Saccharomyces cerevisiae.
26000982 2015 SEPTIN2 and STATHMIN Regulate CD99-Mediated Cellular Differentiation in Hodgkin's Lymphoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25592041 2015 Activation of peroxisome proliferator-activated receptor-? (PPAR?) inhibits hepatoma cell growth via downregulation of SEPT2 expression.
25588830 2015 SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25293760 2014 Septins arrange F-actin-containing fibers on the Chlamydia trachomatis inclusion and are required for normal release of the inclusion by extrusion.
24787956 2014 In silico docking of forchlorfenuron (FCF) to septins suggests that FCF interferes with GTP binding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23572511 2013 Septins 2, 7 and 9 and MAP4 colocalize along the axoneme in the primary cilium and control ciliary length.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21967827 2012 Self assembly of human septin 2 into amyloid filaments.
21788367 2011 Septin GTPases spatially guide microtubule organization and plus end dynamics in polarizing epithelia.
21767235 2011 Characterization of human septin interactions.
21504731 2011 A role for septins in the interaction between the Listeria monocytogenes INVASION PROTEIN InlB and the Met receptor.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21082023 2010 A draft of the human septin interactome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20870893 2011 Septin-2 mediates airway epithelial barrier function in physiologic and pathologic conditions.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19234302 2009 Septin 11 restricts InlB-mediated invasion by Listeria.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19165576 2009 The phosphorylation of SEPT2 on Ser218 by casein kinase 2 is important to hepatoma carcinoma cell proliferation.
19145258 2009 Septins regulate bacterial entry into host cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18656699 2008 A novel MLL-SEPT2 fusion variant in therapy-related myelodysplastic syndrome.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18209106 2008 Epithelial polarity requires septin coupling of vesicle transport to polyglutamylated microtubules.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17803907 2007 Septins regulate actin organization and cell-cycle arrest through nuclear accumulation of NCK mediated by SOCS7.
17685441 2007 Sept12 is a component of the mammalian sperm tail annulus.
17637674 2007 Structural insight into filament formation by mammalian septins.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17229681 2007 An RNA-binding protein, hnRNP A1, and a scaffold protein, septin 6, facilitate hepatitis C virus replication.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16914550 2006 Structural analysis of septin 2, 6, and 7 complexes.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16682951 2006 SEPT2 is a new fusion partner of MLL in acute myeloid leukemia with t(2;11)(q37;q23).
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16093351 2005 Mammalian septins regulate microtubule stability through interaction with the microtubule-binding protein MAP4.
15987492 2005 Screening of an endothelial cDNA library identifies the C-terminal region of Nedd5 as a novel autoantigen in systemic lupus erythematosus with psychiatric manifestations.
15915442 2005 Expression profiling the human septin gene family.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15774761 2005 A mitotic septin scaffold required for Mammalian chromosome congression and segregation.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485874 2004 Biochemical and cell biological analyses of a mammalian septin complex, Sept7/9b/11.
15150837 2004 Septin 2 phosphorylation: theoretical and mass spectrometric evidence for the existence of a single phosphorylation site in vivo.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14531065 Interaction of the S100A4 (Mts1) protein with septins Sept2, Sept6, and Sept7 in vitro.
12544826 2003 The septin protein Nedd5 associates with both the exocyst complex and microtubules and disruption of its GTPase activity promotes aberrant neurite sprouting in PC12 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446710 2003 Borg/septin interactions and the assembly of mammalian septin heterodimers, trimers, and filaments.
12388755 2002 The mammalian septin MSF localizes with microtubules and is required for completion of cytokinesis.
12125979 2002 Expression of Nedd5, a mammalian septin, in human brain tumors.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
10321247 1999 The septin CDCrel-1 binds syntaxin and inhibits exocytosis.
9847074 1998 Toward a complete human genome sequence.
9811347 1998 Identification of septins in neurofibrillary tangles in Alzheimer's disease.
9655500 1998 Subunit composition, protein interactions, and structures of the mammalian brain sec6/8 complex and septin filaments.
9203580 1997 Nedd5, a mammalian septin, is a novel cytoskeletal component interacting with actin-based structures.
8697812 1996 Isolation and mapping of a human gene (DIFF6) homologous to yeast CDC3, CDC10, CDC11, and CDC12, and mouse Diff6.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.