Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.93
PubTator Score 16.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 2.450 8.5e-05
glioblastoma 1.900 9.2e-08
osteosarcoma 1.021 4.6e-02
ependymoma 1.800 2.1e-11
sonic hedgehog group medulloblastoma 2.800 2.7e-07
atypical teratoid / rhabdoid tumor 1.800 2.0e-05
medulloblastoma, large-cell 1.200 1.2e-02
primitive neuroectodermal tumor 2.000 3.2e-06
tuberculosis and treatment for 6 months -1.900 7.4e-05
pediatric high grade glioma 1.700 5.0e-06
pilocytic astrocytoma 1.100 1.1e-03
lung adenocarcinoma -1.900 1.3e-10
pulmonary arterial hypertension -4.100 3.6e-02
lung carcinoma -1.100 6.1e-13
spina bifida -1.058 4.2e-02
Breast cancer -1.100 3.1e-07
mucosa-associated lymphoid tissue lympho... 2.000 2.9e-02
invasive ductal carcinoma -1.400 9.2e-03
ovarian cancer -2.100 4.2e-06
Down syndrome 1.400 5.1e-04
dermatomyositis 1.200 2.5e-03

Gene RIF (3)

PMID Text
22320903 we found that paclitaxel-resistant tumors had decreased expression of SEPT10.
17657217 Lack of SEPT10 transcript is associated with B-cell chronic lymphocytic leukemia
12711328 Cloning and functional characterization of septin 10.

AA Sequence

MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVGFESLPDQLVNRSIQQGFCFNIL      1 - 70
CVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQ     71 - 140
PIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKA    141 - 210
DTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGNKMVKARQY    211 - 280
PWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEA    281 - 350
KRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAF    351 - 420
SKKKATSEIFHSQSFLATGSNLRKDKDRKNSNFL                                        421 - 454
//

Text Mined References (14)

PMID Year Title
26038121 2015 Surrogate molecular markers for IGHV mutational status in chronic lymphocytic leukemia for predicting time to first treatment.
25416956 2014 A proteome-scale map of the human interactome network.
22320903 2012 Identification of a novel role of Septin 10 in paclitaxel-resistance in cancers through a functional genomics screen.
21269460 2011 Initial characterization of the human central proteome.
20195767 2010 Linking the septin expression with carcinogenesis.
17657217 2008 Are surrogates of IGHV gene mutational status useful in B-cell chronic lymphocytic leukemia? The example of Septin-10.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15915442 2005 Expression profiling the human septin gene family.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12711328 2003 Cloning and functional characterization of human septin 10, a novel member of septin family cloned from dendritic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475938 2002 Mammalian septins nomenclature.