Property Summary

NCBI Gene PubMed Count 21
PubMed Score 87.42
PubTator Score 134.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 8.7e-10
group 4 medulloblastoma 1875 4.2e-05
interstitial cystitis 2299 4.6e-03
Disease Target Count Z-score Confidence
Yaws 8 3.358 1.7
Juvenile absence epilepsy 4 3.158 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -4.448 8.7e-10
interstitial cystitis 1.600 4.6e-03
group 4 medulloblastoma -1.500 4.2e-05

Gene RIF (3)

PMID Text
23087102 The SEPT1 may participate in cell-cell and/or cell-substrate interaction in DJM-1 and exert its function in a coordinated manner with other septins.
17912427 An increase in Sept1 expression in all oral squamous-cell carcinoma-derived cell lines compared to human normal oral keratinocytes and oral premalignant lesions suggest that Sept1 expression could contribute to cancer progression, proliferation, or both.
16179162 Aurora-B binds and phosphorylates Septin1.

AA Sequence

MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIE      1 - 70
RRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYF     71 - 140
ISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDE    141 - 210
DFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEV    211 - 280
THDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKM    281 - 350
QAQMQQSQAQGEQSDAL                                                         351 - 367
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23087102 2013 Possible role of a septin, SEPT1, in spreading in squamous cell carcinoma DJM-1 cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21809895 2011 Septin genomics: a road less travelled.
21269460 2011 Initial characterization of the human central proteome.
21082023 2010 A draft of the human septin interactome.
20236126 2010 Conquering the complex world of human septins: implications for health and disease.
20136629 2009 Structural and expression changes of septins in myeloid neoplasia.
19799413 2009 From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17967425 2007 Phylogenetic and evolutionary analysis of the septin protein family in metazoan.
17912427 2007 Overexpression of Septin1: possible contribution to the development of oral cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16179162 2005 Septin1, a new interaction partner for human serine/threonine kinase aurora-B.
15915442 2005 Expression profiling the human septin gene family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475938 2002 Mammalian septins nomenclature.
9811347 1998 Identification of septins in neurofibrillary tangles in Alzheimer's disease.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.
2174398 1990 Lymphocyte HEV adhesion variants differ in the expression of multiple gene sequences.