Property Summary

NCBI Gene PubMed Count 15
PubMed Score 51.60
PubTator Score 27.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.4e-05
group 3 medulloblastoma 1.500 1.6e-03
invasive ductal carcinoma 1.100 3.9e-02
lung cancer 1.300 7.0e-03
non primary Sjogren syndrome sicca 1.100 2.2e-02
osteosarcoma -1.021 5.7e-03
ovarian cancer 1.200 1.8e-03
psoriasis -1.600 4.2e-05

Gene RIF (6)

AA Sequence

MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDT      1 - 70
CVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKV     71 - 140
MPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVA    141 - 210
VHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAK    211 - 280
QQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQ    281 - 350
AWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS                                351 - 392
//

Text Mined References (22)

PMID Year Title