Property Summary

NCBI Gene PubMed Count 23
PubMed Score 251.64
PubTator Score 151.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.100 6.8e-05
posterior fossa group B ependymoma 1.200 9.6e-08
ulcerative colitis -1.100 7.6e-06

MLP Assay (13)

AID Type Active / Inconclusive / Inactive Description
2540 screening 4122 / 0 / 326358 HTS Luminescent assay for identification of inhibitors of Sentrin-specific protease 8 (SENP8)
2575 summary 0 / 0 / 0 Summary assay for identification of inhibitors of Sentrin-specific protease 8 (SENP8)
488903 confirmatory 540 / 0 / 164 Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 8 (SENP8) using a Luminescent assay
488912 screening 2491 / 0 / 3705 Single concentration confirmation of uHTS for inhibitors of Sentrin-specific protease 8 (SENP8) using a Luminescent assay
488919 screening 2417 / 0 / 3779 Single concentration confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Luminescent Interference Counterscreen assay
488920 confirmatory 15 / 0 / 12 Dose Response confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Luminescent Interference Counterscreen assay
504501 confirmatory 93 / 0 / 174 SAR Analysis of small molecule inhibitors of Sentrin-specific protease 8 (SENP8) using a Luminescent assay
588601 confirmatory 48 / 0 / 53 SAR Analysis of small molecule inhibitors of Sentrin-specific protease 8 (SENP8) using a Luminescent assay - Set 2
602440 screening 2342 / 0 / 361826 uHTS Fluorescent Assay Using Nedd8 Protein Substrate for Identification of Inhibitors of Sentrin-Specific Protease 8 (SENP8)
602488 summary 0 / 0 / 0 Summary assay for small molecule Inhibitors of Sentrin-Specific Protease 8 (SENP8) Using Nedd8 Protein Substrate
More...

Gene RIF (10)

PMID Text
26403403 the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype.
25655932 In endothelial dysfunction, HDAC2 levels were reciprocally regulated by ectopic expression of NEDD8 and the de-NEDDylating enzyme SENP8.
23408908 We analyzed whether CSN1 alone can increase DEN1 degradation in HeLa cells.these data suggest that the COP9 signalosome supports proteasome-dependent protein degradation of DEN1/DenA in fungi and in human cells.
23209320 A role for SENP8 as a central regulator of the inflammatory process is identified using knockdown and overexpression approaches.
23001041 Data indicate that overexpression of SENP8, a NEDD8-specific cysteine protease, resulted in deNEDDylation of E2F1 and promoted its transactivation activity at the p73 gene.
22110750 the specificity of NEDD8-specific peptidase SENP8
19784069 Data show that the stability of MDM2 is regulated by NEDD8 pathway and identify NEDP1 that deneddylates MDM2, resulting in MDM2 destabilization concomitant with p53 activation.
15567417 X-ray structures of the human Nedd8-specific protease, Den1, in a complex with the inhibitor Nedd8 aldehyde, thus revealing a model for the tetrahedral transition state intermediate generated during proteolysis
12759363 results suggest a unique role for NEDD8-specific protease 1(DEN1) in regulating the modification of cullin 1 by Nedd8 protein
12730221 NEDP1 is likely to play an important role in ubiquitin-mediated proteolysis by controlling the activity of SCF complexes

AA Sequence

MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAE      1 - 70
IAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFL     71 - 140
GRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLA    141 - 210
KK                                                                        211 - 212
//

Text Mined References (25)

PMID Year Title
26403403 PAPILLARY THYROID CANCER IS CHARACTERIZED BY ALTERED EXPRESSION OF GENES INVOLVED IN THE SUMOYLATION PROCESS.
25655932 2015 NEDDylation promotes endothelial dysfunction: a role for HDAC2.
23408908 2013 Control of multicellular development by the physically interacting deneddylases DEN1/DenA and COP9 signalosome.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23209320 2013 Central role for endothelial human deneddylase-1/SENP8 in fine-tuning the vascular inflammatory response.
23001041 2013 NEDDylation controls the target specificity of E2F1 and apoptosis induction.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22110750 2011 The molecular determinants of NEDD8 specific recognition by human SENP8.
19784069 2010 Chemotherapy induces NEDP1-mediated destabilization of MDM2.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19328766 2009 A time-resolved fluorescence resonance energy transfer-based assay for DEN1 peptidase activity.
18666185 2008 DeSUMOylating enzymes--SENPs.
17591783 2007 Small ubiquitin-related modifier (SUMO)-specific proteases: profiling the specificities and activities of human SENPs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15775960 2005 Structural basis of NEDD8 ubiquitin discrimination by the deNEDDylating enzyme NEDP1.
15567417 2005 Structure of a complex between Nedd8 and the Ulp/Senp protease family member Den1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15242646 2004 Mdm2-mediated NEDD8 conjugation of p53 inhibits its transcriptional activity.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12759363 2003 DEN1 is a dual function protease capable of processing the C terminus of Nedd8 and deconjugating hyper-neddylated CUL1.
12759362 2003 Identification and characterization of DEN1, a deneddylase of the ULP family.
12730221 2003 NEDP1, a highly conserved cysteine protease that deNEDDylates Cullins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.