Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.09
PubTator Score 7.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.500 1.0e-05
osteosarcoma -1.210 2.6e-06
ependymoma -1.100 2.0e-10
atypical teratoid / rhabdoid tumor -1.100 8.5e-06
glioblastoma -1.200 6.6e-06
medulloblastoma, large-cell -1.200 1.2e-04
non-small cell lung cancer 1.331 5.1e-12
pediatric high grade glioma -1.100 1.2e-06
Breast cancer 1.100 1.2e-05

Gene RIF (6)

PMID Text
25901414 Mild oxidative stress stabilized the SENP5 protein in the oral squamous cell carcinoma cells, and only the combination of SENP5 silencing and H2O2 application led to mitochondria fragmentation and a significant increase in cell apoptosis.
24658161 Low expression of SENP5 is associated with good prognosis among breast cancer patients.
19015314 Nucleolar protein B23/nucleophosmin regulates the vertebrate SUMO pathway through SENP3 and SENP5 proteases.
18976975 Knockdown of SUMO1/sentrin specific peptidase 5 (SENP5) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18949399 altered subcellular localization of SENP5 in oral squamous cell carcinoma (OSCC) cells and the correlation between SENP5 expression and the differentiation of OSCC.
16738315 Knockdown of SENP5 resulted in increased levels of SUMO-1 and SUMO-2/3, inhibition of cell proliferation, defects in nuclear morphology, and appearance of binucleate cells, revealing an essential role for SENP5 in mitosis and/or cytokinesis.

AA Sequence

MKKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTW      1 - 70
IKDEPLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSKTLLRLQAEKLLSSAKNSDHEYCREKNLLKAV     71 - 140
TDFPSNSALGQANGHRPRTDPQPSDFPMKFNGESQSPGESGTIVVTLNNHKRKGFCYGCCQGPEHHRNGG    141 - 210
PLIPKKFQLNQHRRIKLSPLMMYEKLSMIRFRYRILRSQHFRTKSKVCKLRKAQRSWVQKVTGDHQETRR    211 - 280
ENGEGGSCSPFPSPEPKDPSCRHQPYFPDMDSSAVVKGTNSHVPDCHTKGSSFLGKELSLDEAFPDQQNG    281 - 350
SATNAWDQSSCSSPKWECTELIHDIPLPEHRSNTMFISETEREIMTLGQENQTSSVSDDRVKLSVSGADT    351 - 420
SVSSVDGPVSQKAVQNENSYQMEEDGSLKQSILSSELLDHPYCKSPLEAPLVCSGLKLENQVGGGKNSQK    421 - 490
ASPVDDEQLSVCLSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYRARHQKCNF    491 - 560
RIFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDKVHFFNSFFHRQLVTKGYNGVKRWTKKVD    561 - 630
LFKKSLLLIPIHLEVHWSLITVTLSNRIISFYDSQGIHFKFCVENIRKYLLTEAREKNRPEFLQGWQTAV    631 - 700
TKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKELCECRLMD                   701 - 755
//

Text Mined References (15)

PMID Year Title
25901414 2015 Sentrin/small ubiquitin-like modifier-specific protease 5 protects oral cancer cells from oxidative stress-induced apoptosis.
25406032 2014 Modification of DBC1 by SUMO2/3 is crucial for p53-mediated apoptosis in response to DNA damage.
24658161 2014 SENP5 mediates breast cancer invasion via a TGF?RI SUMOylation cascade.
21217774 2011 RAC3 is a pro-migratory co-activator of ER?.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19015314 2008 Nucleolar protein B23/nucleophosmin regulates the vertebrate SUMO pathway through SENP3 and SENP5 proteases.
18949399 2008 Overexpression of SENP5 in oral squamous cell carcinoma and its association with differentiation.
17591783 2007 Small ubiquitin-related modifier (SUMO)-specific proteases: profiling the specificities and activities of human SENPs.
16738315 2006 The SUMO-specific protease SENP5 is required for cell division.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16608850 2006 Characterization of a family of nucleolar SUMO-specific proteases with preference for SUMO-2 or SUMO-3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10806345 2000 Ubiquitin-like proteins: new wines in new bottles.