Property Summary

NCBI Gene PubMed Count 62
PubMed Score 265.61
PubTator Score 28.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.2e-04

Gene RIF (31)

PMID Text
25631074 Cellular biotinylated semenogelin I protein (SEMG1) is incorporated into HIV-1 Gag virus-like particles
25027395 Data indicate that semenogelin I (Sg I) expression has potential value in predicting renal cell carcinoma (RCC) progression and prognosis, suggesting the use of Sg I as a biomarker for RCC.
24811874 Three regions of SEM1(86-107) comprise the amyloid fibril core that enhances HIV-1 infection.
24312623 EPPIN and SEMG1 rapidly co-evolved in primates
23289976 SEMG1 was significantly changed in asthenozoosperm, which could be the candidate gene for the development of diagnostic marker and provided the opportunity to further illustrate the biological mechanisms of asthenozoospermia.
23085372 Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma
22699487 EPPIN's semenogelin I binding site: a contraceptive drug target.
22617231 Nuclear semenogelin I expression could be a reliable prognosticator in men who undergo radical prostatectomy.
22177559 Peptides released by physiological cleavage of Semg1 and Semg2 form amyloids that enhance HIV infection.
21557275 These results suggest the involvement of semenogelins in prostate cancer and their prognostic values in predicting cancer progression after radical prostatectomy.
21525168 The proteomes of the type-1 diabetic, type-2 diabetic, and non-diabetic obese patients presented elevated amounts of the same set of one molecular form of semenogelin-1, one form of clusterin, and two forms of lactotransferrin.
20378931 Spermatozoa interact with semenogelin I in solution in a non-Zn2+-dependent manner, but associate with immobilized semenogelin I only in the presence of Zn2+.
19889947 Cysteine 239 of rSEMG1 appears to be the critical amino acid for both binding to eppin and inhibiting sperm motility.
19241194 expressed in 46% of patients with early stage chronic lymphocytic leukemia; potential target for cancer vaccines
19089943 Semenogelins (Sgs) modifies the membrane structure, indirectly inhibiting motility, and provides suggestions for a therapy for male infertility through selection of a functional sperm population using Sgs.
18714013 antibacterial activity of the semenogelin-derived peptides generated in seminal plasma was strictly zinc-dependent both at neutral and low pH
18482984 semenogelins I and II were directly cleaved by KLK14. Semenogelins were also able to reverse KLK14 inhibition by Zn2+, providing a novel regulatory mechanism for KLK14 activity.
18468680 SEMG I expression in myeloma cells can be upregulated by 5-azacytidine, IL-4 and IL-6.
18314226 Peptides from the antimicrobial protein semenogelin I have antibacterial activity.
17683036 SGI is a novel target for protein S-nitrosylation in spermatozoa.
17680810 The conformational change induced in semenogelin I by the binding of Zn(2+) may contribute to the ability of this protein to form a gel
17624925 The semenogelin-CD52 soluble form is a direct consequence of the liquefaction process in human semen.
16582407 truncated (lacking 60 amino acids ) & wild-type semenogelin molecules had similar Zn(2+)-binding properties & they showed also similar susceptibility for degradation by prostate-specific antigen
15962837 The study provides evidence that senile seminal vesicle amyloid is derived from SgI; this form of amyloidosis was provisionally designated as ASgI.
15930278 Authors analyzed an intronic T9 repeat of semenogelin I (SEMG1) and report mutation frequencies of 51% (75 of 146) and 62% (8 of 13) in MMR-deficient primary colorectal cancers and cell lines, respectively.
15590901 in seminal plasma and on spermatozoa following ejaculation, Eppin is bound to semenogelin I
15563730 The binding of Zn2+ to SgI and SgII and their involvment in regulating the activity of PSA are reported.
14629036 structural changes in the semenogelin 1 and 2 proteins that have arisen since the human-chimpanzee-gorilla split may be responsible for the physiological differences between these species ejaculated semen that correlate with their sociosexual behavior
14613901 peptides produced by cleavage of semenogelin I, the predominant human semen coagulum protein, had high levels of antibacterial activity.
14581514 Seminal plasma motility inhibitor, one of the fragments of Sg, has its inhibitory effect on ejaculated spermatozoa in liquefied semen under physiological conditions.
12200457 Transcripts in the gastro-intestinal tract and skeletal muscle almost exclusively encoded SgI

AA Sequence

MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYH      1 - 70
VDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQ     71 - 140
NPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRET    141 - 210
KNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHG    211 - 280
RKANKISYQSSSTEERRLHYGENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS    281 - 350
SSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSH    351 - 420
EQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT                                421 - 462
//

Text Mined References (62)

PMID Year Title
25027395 2014 Seminal plasma protein in renal cell carcinoma: expression of semenogelin I is a predictor for cancer progression and prognosis.
24811874 2014 Structural characterization of semen coagulum-derived SEM1(86-107) amyloid fibrils that enhance HIV-1 infection.
24312623 2013 Interacting proteins on human spermatozoa: adaptive evolution of the binding of semenogelin I to EPPIN.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23289976 2014 SEMG1 may be the candidate gene for idiopathic asthenozoospermia.
23085372 2013 Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma.
22699487 2012 Characterization of EPPIN's semenogelin I binding site: a contraceptive drug target.
22617231 2012 Seminal plasma proteins in prostatic carcinoma: increased nuclear semenogelin I expression is a predictor of biochemical recurrence after radical prostatectomy.
22177559 2011 Peptides released by physiological cleavage of semen coagulum proteins form amyloids that enhance HIV infection.
22075473 2012 Loss of calcium in human spermatozoa via EPPIN, the semenogelin receptor.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21557275 2011 Expression of semenogelins I and II and its prognostic significance in human prostate cancer.
21525168 2011 Identification of increased amounts of eppin protein complex components in sperm cells of diabetic and obese individuals by difference gel electrophoresis.
20378931 Binding of semenogelin I to intact human spermatozoa studied by flow cytometry and surface plasmon resonance.
19889947 2010 Analysis of recombinant human semenogelin as an inhibitor of human sperm motility.
19241194 2009 SEMG-1 expression in early stage chronic lymphocytic leukemia.
19089943 2009 Functional implications of membrane modification with semenogelins for inhibition of sperm motility in humans.
18714013 2008 The major bactericidal activity of human seminal plasma is zinc-dependent and derived from fragmentation of the semenogelins.
18482984 2008 Major role of human KLK14 in seminal clot liquefaction.
18468680 2008 Semenogelin I expression in myeloma cells can be upregulated pharmacologically.
18314226 2008 Identification of novel semenogelin I-derived antimicrobial peptide from liquefied human seminal plasma.
17683036 2007 Human spermatozoa contain multiple targets for protein S-nitrosylation: an alternative mechanism of the modulation of sperm function by nitric oxide?
17680810 2007 Structural properties of semenogelin I.
17624925 2008 The GPI-anchored CD52 antigen of the sperm surface interacts with semenogelin and participates in clot formation and liquefaction of human semen.
17567961 2007 Characterization of an eppin protein complex from human semen and spermatozoa.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16582407 Truncated semenogelin I binds zinc and is cleaved by prostate-specific antigen.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15962837 2005 Senile seminal vesicle amyloid is derived from semenogelin I.
15930278 2005 Mutations in two short noncoding mononucleotide repeats in most microsatellite-unstable colorectal cancers.
15590901 2005 Association of eppin with semenogelin on human spermatozoa.
15563730 2005 Semenogelins I and II bind zinc and regulate the activity of prostate-specific antigen.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14629036 2003 Evolution of the hominoid semenogelin genes, the major proteins of ejaculated semen.
14613901 2004 Involvement of semenogelin-derived peptides in the antibacterial activity of human seminal plasma.
14581514 Quantification of seminal plasma motility inhibitor/semenogelin in human seminal plasma.
14562960 2003 Reduced polymorphism in the chimpanzee semen coagulating protein, semenogelin I.
12771235 2003 A frequent allele codes for a truncated variant of semenogelin I, the major protein component of human semen coagulum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399526 Exogenous protein kinases A and C, but not endogenous prostasome-associated protein kinase, phosphorylate semenogelins I and II from human semen.
12200457 2002 Semenogelin I and II, the predominant human seminal plasma proteins, are also expressed in non-genital tissues.
11870067 2002 Monoclonal antibodies, immunofluorometric assay, and detection of human semenogelin in male reproductive tract: no association with in vitro fertilizing capacity of sperm.
11784334 2002 Amidolytic activity of prostatic acid phosphatase on human semenogelins and semenogelin-derived synthetic substrates.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11027412 2000 Enzymatic action of prostate-specific antigen (PSA or hK3): substrate specificity and regulation by Zn(2+), a tight-binding inhibitor.
10412373 1999 Semenogelin I: a coagulum forming, multifunctional seminal vesicle protein.
10411640 1999 Enzymatic action of human glandular kallikrein 2 (hK2). Substrate specificity and regulation by Zn2+ and extracellular protease inhibitors.
9523691 1998 Semenogelin I and semenogelin II, the major gel-forming proteins in human semen, are substrates for transglutaminase.
9092810 1997 Characterization of prostate-specific antigen proteolytic activity on its major physiological substrate, the sperm motility inhibitor precursor/semenogelin I.
8833737 Distribution and tissue expression of semenogelin I and II in man as demonstrated by in situ hybridization and immunocytochemistry.
8665956 1996 Characterization of semenogelin II and its molecular interaction with prostate-specific antigen and protein C inhibitor.
8665951 1996 Isolation and characterization of the major gel proteins in human semen, semenogelin I and semenogelin II.
8654389 1996 The structure of the semenogelin gene locus--nucleotide sequence of the intergenic and the flanking DNA.
8444163 1993 Isolation and identification of N-terminally extended forms of 5-oxoprolylglutamylprolinamide (Glp-Glu-Pro-NH2), a thyrotropin-releasing-hormone (TRH)-like peptide present in human semen.
6698208 1984 Partial amino acid sequence of a human seminal plasma peptide with inhibin-like activity.
6484484 1984 Characterization of the predominant basic protein in human seminal plasma, one cleavage product of the major seminal vesicle protein.
6422553 1984 Isolation, structure, and synthesis of a human seminal plasma peptide with inhibin-like activity.
3972122 1985 Amino acid sequence of the predominant basic protein in human seminal plasma.
3889920 1985 Human seminal alpha inhibins: isolation, characterization, and structure.
2912989 1989 Semenogelin, the predominant protein in human semen. Primary structure and identification of closely related proteins in the male accessory sex glands and on the spermatozoa.
2757795 1989 [Isolation and structure determination of two peptides occurring in human seminal plasma].
1517240 1992 Gene structure of semenogelin I and II. The predominant proteins in human semen are encoded by two homologous genes on chromosome 20.