Property Summary

NCBI Gene PubMed Count 39
PubMed Score 94.50
PubTator Score 47.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma -1.300 3.7e-08
cystic fibrosis 1.473 8.4e-05
atypical teratoid / rhabdoid tumor -1.700 6.2e-09
glioblastoma -1.100 2.6e-03
medulloblastoma, large-cell -1.500 3.0e-04
tuberculosis -1.300 1.5e-06
adult high grade glioma -1.500 1.2e-04
group 4 medulloblastoma -1.300 4.2e-04
subependymal giant cell astrocytoma -1.058 4.3e-02
pituitary cancer 1.700 3.9e-05
psoriasis 1.100 1.0e-30

 GWAS Trait (1)

Gene RIF (21)

PMID Text
26752048 SEMA7A has a role in the development of lung injury
26597008 This study demonstrates that Sema7A controls the assembly of actin-based protrusions that drive Dendritic cell migration in response to CCL21.
26432853 Sema3A and sema7A expression correlated with the inflammatory activity of the multiple sclerosis (MS) lesions, suggesting their involvement in the immunological process that takes place in MS.
25406498 These results suggest that SEMA7a plays a role as a CSF biomarkers associated with the conversion to clinically definite multiple sclerosis in clinically isolated syndromes patients
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of semaphorin 7A, GPI membrane anchor (SEMA7A, CD108)
24522099 heterozygous missense variants in SEMA3A and SEMA7A may modify the phenotype of Kallmann syndrome but most likely are not alone sufficient to cause the disorder
24333536 Semaphorin 7A is a potentially important modulator of eosinophil profibrotic functions in the airway remodeling of patients with chronic asthma.
23850082 SEMA7A was expressed in the liver and was increased in the course of liver fibrosis, both in mice and in humans.
23166499 two MTRAP monomers interact via their tandem TSR domains with the Sema domains of a Semaphorin-7A homodimer
22891341 We report here the expression and induction of semaphorin 7A (SEMA7A) on endothelium through hypoxia-inducible factor 1alpha during hypoxia.
22845496 Semaphorin 7A protein variants differentially regulate T-cell activity.
22448926 Sema7A markedly reduces the production rates of megakaryocytes and platelets from CD34(+) progenitor cells.
21524887 Sema7A on keratinocytes and beta1-integrin on monocytes contribute to monocyte activation by keratinocytes within skin inflammation, inducing IL-8
20854351 A new SEMA7A variant was identified in Native American plasma samples, and an alloantibody that recognizes the wild-type protein
20727575 Study reports the structures of Sema7A and A39R complexed with the Semaphorin-binding module of PlexinC1; both structures show two PlexinC1 molecules symmetrically bridged by Semaphorin dimers.
19318806 Sema7A binds to human melanocytes through beta1-integrins and the Plexin C1 receptor
17671519 beta1-integrins and Plexin C1 receptors are ligands for Semaphorin 7a, and that signaling by these receptors has opposing effects on Semaphorin 7a-induced dendrite formation.
16372136 Observational study of gene-disease association. (HuGE Navigator)
16372136 Polymorphisms in SEMA7A may play a role in decreased bone mineral density and increased risk of vertebral fracture.
15907379 SEMA 7A might be a molecule involved in the terminal innervation of the dentin-pulp complex.
12193228 Sema7A is a potent stimulator of cytokine production, chemotaxis and superoxide release in monocytes

AA Sequence

MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHVGQDRVDFG      1 - 70
QTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGL     71 - 140
LACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTIRKQEYNGKIPRFRRIRGES    141 - 210
ELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSK    211 - 280
WNTFLKAMLVCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSS    281 - 350
LKGYHSSLPNPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH    351 - 420
GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPL    421 - 490
DLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNS    491 - 560
RYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLL    561 - 630
PEDGIMAEHLLGHACALAASLWLGVLPTLTLGLLVH                                      631 - 666
//

Text Mined References (40)

PMID Year Title
26752048 2016 Semaphorin 7A Aggravates Pulmonary Inflammation during Lung Injury.
26597008 2016 Semaphorin 7A Promotes Chemokine-Driven Dendritic Cell Migration.
26432853 2015 Expression of semaphorin 3A, semaphorin 7A and their receptors in multiple sclerosis lesions.
25406498 2014 Validation of semaphorin 7A and ala-?-his-dipeptidase as biomarkers associated with the conversion from clinically isolated syndrome to multiple sclerosis.
24522099 2014 Mutation screening of SEMA3A and SEMA7A in patients with congenital hypogonadotropic hypogonadism.
24333536 2014 Semaphorin 7A is expressed on airway eosinophils and upregulated by IL-5 family cytokines.
23850082 2013 Semaphorin 7A contributes to TGF-?-mediated liver fibrogenesis.
23166499 2012 Semaphorin-7A is an erythrocyte receptor for P. falciparum merozoite-specific TRAP homolog, MTRAP.
22891341 2012 Endothelial Semaphorin 7A promotes neutrophil migration during hypoxia.
22845496 2013 Semaphorin 7A protein variants differentially regulate T-cell activity.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22448926 2012 Semaphorin 7A inhibits platelet production from CD34+ progenitor cells.
21524887 2011 Semaphorin 7A on keratinocytes induces interleukin-8 production by monocytes.
20854351 2011 A new SEMA7A variant found in Native Americans with alloantibody.
20727575 2010 Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1.
19318806 2009 The semaphorin 7A receptor Plexin C1 is lost during melanoma metastasis.
18987670 2009 Plexin C1, a receptor for semaphorin 7a, inactivates cofilin and is a potential tumor suppressor for melanoma progression.
18422858 2008 Rapid detection of JMH antibodies with recombinant Sema7A (CD108) protein and the particle gel immunoassay.
17671519 2008 Semaphorin 7a promotes spreading and dendricity in human melanocytes through beta1-integrins.
17485510 2007 Semaphorin 7A plays a critical role in TGF-beta1-induced pulmonary fibrosis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17377534 2007 Semaphorin 7A initiates T-cell-mediated inflammatory responses through alpha1beta1 integrin.
17207242 2007 The molecular diversity of Sema7A, the semaphorin that carries the JMH blood group antigens.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16372136 2006 Association study of semaphorin 7a (sema7a) polymorphisms with bone mineral density and fracture risk in postmenopausal Korean women.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
16199891 2005 Comparative proteomic analysis of intra- and interindividual variation in human cerebrospinal fluid.
15907379 2005 Odontoblast expression of semaphorin 7A during innervation of human dentin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12879062 2003 Semaphorin 7A promotes axon outgrowth through integrins and MAPKs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12193228 2002 Sema7A is a potent monocyte stimulator.
10885563 2000 CDw108 expression during T-cell development.
10520995 1999 Plexins are a large family of receptors for transmembrane, secreted, and GPI-anchored semaphorins in vertebrates.
10416131 1999 Characterization of the human leukocyte GPI-anchored glycoprotein CDw108 and its relation to other similar molecules.
10201933 1999 Molecular cloning of a glycosylphosphatidylinositol-anchored molecule CDw108.
9721204 1998 New eukaryotic semaphorins with close homology to semaphorins of DNA viruses.
9712866 1998 Human semaphorin K1 is glycosylphosphatidylinositol-linked and defines a new subfamily of viral-related semaphorins.