Property Summary

NCBI Gene PubMed Count 17
PubMed Score 15.10
PubTator Score 8.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 2.0e-02
Breast cancer -1.200 4.7e-06
breast carcinoma -1.800 3.5e-27
colon cancer -2.100 1.8e-04
cystic fibrosis -1.045 8.7e-04
intraductal papillary-mucinous adenoma (... -1.100 5.6e-04
intraductal papillary-mucinous carcinoma... -3.100 8.7e-04
intraductal papillary-mucinous neoplasm ... -1.400 1.4e-03
invasive ductal carcinoma -2.000 3.0e-03
lung adenocarcinoma -1.700 3.0e-14
lung cancer -1.100 2.7e-02
medulloblastoma 1.200 7.0e-03
medulloblastoma, large-cell 1.900 2.5e-04
non-small cell lung carcinoma -1.300 5.4e-16
osteosarcoma 2.769 2.3e-06
ovarian cancer -1.800 4.9e-10
pancreatic cancer -1.300 5.2e-04
Pick disease -1.100 5.2e-03
pituitary cancer 1.800 9.9e-05
progressive supranuclear palsy -1.600 1.1e-02
ulcerative colitis -1.400 7.8e-04

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY      1 - 70
IAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHNFIKVFVPRNDEMVFVCGTNA     71 - 140
FNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFADGKLYSATVADFLASDAVIYRSMGDGSALRT    141 - 210
IKYDSKWIKEPHFLHAIEYGNYVYFFFREIAVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKA    211 - 280
RLNCSVPGDSFFYFDVLQSITDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTP    281 - 350
DSVWTAVPEDKVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYR    351 - 420
LTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAKCSAENEEDKKVISL    421 - 490
QLDKDHHALYVAFSSCIIRIPLSRCERYGSCKKSCIASRDPYCGWLSQGSCGRVTPGMLAEGYEQDTEFG    491 - 560
NTAHLGDCHEILPTSTTPDYKIFGGPTSDMEVSSSSVTTMASIPEITPKVIDTWRPKLTSSRKFVVQDDP    561 - 630
NTSDFTDPLSGIPKGVRWEVQSGESNQMVHMNVLITCVFAAFVLGAFIAGVAVYCYRDMFVRKNRKIHKD    631 - 700
AESAQSCTDSSGSFAKLNGLFDSPVKEYQQNIDSPKLYSNLLTSRKELPPNGDTKSMVMDHRGQPPELAA    701 - 770
LPTPESTPVLHQKTLQAMKSHSEKAHGHGASRKETPQFFPSSPPPHSPLSHGHIPSAIVLPNATHDYNTS    771 - 840
FSNSNAHKAEKKLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDIQMAHQNLMLD    841 - 910
PMGSMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSLERQRGYHKNSSQRHSISAMPKN    911 - 980
LNSPNGVLLSRQPSMNRGGYMPTPTGAKVDYIQGTPVSVHLQPSLSRQSSYTSNGTLPRTGLKRTPSLKP    981 - 1050
DVPPKPSFVPQTPSVRPLNKYTY                                                  1051 - 1073
//

Text Mined References (21)

PMID Year Title