Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.57
PubTator Score 8.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
osteosarcoma 2.769 2.3e-06
cystic fibrosis -1.100 1.7e-03
atypical teratoid / rhabdoid tumor -1.700 2.0e-02
medulloblastoma 1.200 7.0e-03
medulloblastoma, large-cell 1.900 2.5e-04
intraductal papillary-mucinous adenoma (... -3.200 1.6e-04
intraductal papillary-mucinous carcinoma... -3.100 8.7e-04
intraductal papillary-mucinous neoplasm ... -3.600 2.5e-03
lung cancer -1.100 2.7e-02
colon cancer -2.100 1.8e-04
pancreatic cancer -1.300 5.2e-04
lung adenocarcinoma -2.000 7.2e-19
Breast cancer -2.900 1.1e-10
non-small cell lung carcinoma -1.300 5.4e-16
breast carcinoma -1.800 3.5e-27
Pick disease -1.600 1.4e-04
progressive supranuclear palsy -1.600 1.1e-02
invasive ductal carcinoma -2.000 3.0e-03
ulcerative colitis -1.400 7.8e-04
ovarian cancer -4.200 1.9e-10
pituitary cancer 1.800 9.9e-05

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17143962 Semaphorin 6D may play an important role in the occurrence and development of gastric carcinoma, and is related to tumor angiogenesis.
12110693 identification, characterization, and functional study of the two novel human members of the semaphorin gene family

AA Sequence

MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY      1 - 70
IAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHNFIKVFVPRNDEMVFVCGTNA     71 - 140
FNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFADGKLYSATVADFLASDAVIYRSMGDGSALRT    141 - 210
IKYDSKWIKEPHFLHAIEYGNYVYFFFREIAVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKA    211 - 280
RLNCSVPGDSFFYFDVLQSITDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTP    281 - 350
DSVWTAVPEDKVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYR    351 - 420
LTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAKCSAENEEDKKVISL    421 - 490
QLDKDHHALYVAFSSCIIRIPLSRCERYGSCKKSCIASRDPYCGWLSQGSCGRVTPGMLAEGYEQDTEFG    491 - 560
NTAHLGDCHEILPTSTTPDYKIFGGPTSDMEVSSSSVTTMASIPEITPKVIDTWRPKLTSSRKFVVQDDP    561 - 630
NTSDFTDPLSGIPKGVRWEVQSGESNQMVHMNVLITCVFAAFVLGAFIAGVAVYCYRDMFVRKNRKIHKD    631 - 700
AESAQSCTDSSGSFAKLNGLFDSPVKEYQQNIDSPKLYSNLLTSRKELPPNGDTKSMVMDHRGQPPELAA    701 - 770
LPTPESTPVLHQKTLQAMKSHSEKAHGHGASRKETPQFFPSSPPPHSPLSHGHIPSAIVLPNATHDYNTS    771 - 840
FSNSNAHKAEKKLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDIQMAHQNLMLD    841 - 910
PMGSMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSLERQRGYHKNSSQRHSISAMPKN    911 - 980
LNSPNGVLLSRQPSMNRGGYMPTPTGAKVDYIQGTPVSVHLQPSLSRQSSYTSNGTLPRTGLKRTPSLKP    981 - 1050
DVPPKPSFVPQTPSVRPLNKYTY                                                  1051 - 1073
//

Text Mined References (21)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24954085 2014 Novel genetic variants modify the effect of smoking on carotid plaque burden in Hispanics.
24785509 2014 A genome wide association study (GWAS) providing evidence of an association between common genetic variants and late radiotherapy toxicity.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22911880 2012 Genome-wide association analysis of eating disorder-related symptoms, behaviors, and personality traits.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17143962 2006 Expression of semaphorin 6D in gastric carcinoma and its significance.
16715077 2006 Plexin-A1 and its interaction with DAP12 in immune responses and bone homeostasis.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14977921 2004 Dual roles of Sema6D in cardiac morphogenesis through region-specific association of its receptor, Plexin-A1, with off-track and vascular endothelial growth factor receptor type 2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12110693 2002 Identification, characterization, and functional study of the two novel human members of the semaphorin gene family.
11842242 2002 Knowing how to navigate: mechanisms of semaphorin signaling in the nervous system.
11102867 2000 Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.