Property Summary

NCBI Gene PubMed Count 21
PubMed Score 116.12
PubTator Score 15.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.062 3.1e-03
astrocytic glioma 3.100 2.0e-03
oligodendroglioma 2.700 2.8e-03
psoriasis -2.600 3.5e-05
osteosarcoma -2.430 1.3e-04
atypical teratoid / rhabdoid tumor 1.600 3.8e-03
glioblastoma 1.400 5.1e-05
medulloblastoma, large-cell 1.300 6.4e-04
primitive neuroectodermal tumor 1.800 1.3e-02
Crohn's disease -1.373 1.1e-02
ulcerative colitis -2.007 1.8e-03
Atopic dermatitis -1.100 4.9e-03
adrenocortical carcinoma -3.204 1.3e-06
non-small cell lung carcinoma -2.500 3.7e-30
intraductal papillary-mucinous adenoma (... -1.800 3.0e-04
intraductal papillary-mucinous neoplasm ... -1.600 5.1e-03
colon cancer -2.000 2.6e-02
lung adenocarcinoma -2.500 6.6e-18
sonic hedgehog group medulloblastoma 3.000 1.7e-05
posterior fossa group B ependymoma -1.200 1.9e-04
invasive ductal carcinoma -2.500 2.2e-03
nasopharyngeal carcinoma 1.100 2.6e-02
lung carcinoma -2.800 2.4e-12
breast carcinoma -1.900 8.9e-41
Breast cancer -3.100 1.5e-12
ductal carcinoma in situ -1.700 1.2e-03
ovarian cancer -1.700 4.6e-13

Gene RIF (9)

PMID Text
26014517 our findings indicated that SEMA6A may be a potential prognostic biomarker in the treatment of Glioblastoma multiforme
25576923 Data suggest that Sema6A and Mical1 may represent new potential therapeutic targets in BRAFV600E melanoma.
23740775 We identified the SEMA6A and HLA-DP loci as significant contributors to risk for granulomatosis with polyangiitis.
22184411 Data show that miR-27a/b regulated the expression of the angiogenesis inhibitor semaphorin 6A (SEMA6A) in vitro and in vivo and targeted the 3'-untranslated region of SEMA6A.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19578876 Observational study of gene-disease association. (HuGE Navigator)
18187809 findings suggest for SEMA6A a novel function in the cytoskeleton and a role in modulating tubulin isotype composition and microtubule dynamics
17671748 NANOG-, SOX2-, and POU5F1 (OCT3/OCT4)-binding sites within intron 1 of the SEMA6A gene
16436660 Strong expression of SEMA6A is associated with langerhans cells of histiocytosis or dermatopathic lymphadenitis

AA Sequence

MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQMIMIMNGTLYI      1 - 70
AARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDALFVCGTNAF     71 - 140
NPSCRNYKMDTLEPFGDEFSGMARCPYDAKHANVALFADGKLYSATVTDFLAIDAVIYRSLGESPTLRTV    141 - 210
KHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKAR    211 - 280
LNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIASVFTGRFKEQKSPD    281 - 350
STWTPVPDERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNRPWFLRTMVRYRL    351 - 420
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNSEKCSYDGVEDKRIMGM    421 - 490
QLDRASSSLYVAFSTCVIKVPLGRCERYGKCKKTCIASRDPYCGWIKEGGACSHLSPNSRLTFEQDIERG    491 - 560
NTDGLGDCHNSFVALNGHSSSLLPSTTTSDSTAQEGYESRGGMLDWKHLLDSPDSTDPLGAVSSHNHQDK    561 - 630
KGVIRESYLKGHDQLVPVTLLAIAVILAFVMGAVFSGITVYCVCDHRRKDVAVVQRKEKELTHSRRGSMS    631 - 700
SVTKLSGLFGDTQSKDPKPEAILTPLMHNGKLATPGNTAKMLIKADQHHLDLTALPTPESTPTLQQKRKP    701 - 770
SRGSREWERNQNLINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEVAQ    771 - 840
MALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQREASLGPPGASLSQTGLSKRLEMHHSS    841 - 910
SYGVDYKRSYPTNSLTRSHQATTLKRNNTNSSNSSHLSRNQSFGRGDNPPPAPQRVDSIQVHSSQPSGQA    911 - 980
VTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKPSFAPLSTSMKPNDACT                        981 - 1030
//

Text Mined References (23)

PMID Year Title
26014517 2015 SEMA6A is a prognostic biomarker in glioblastoma.
25576923 2015 Sema6A and Mical1 control cell growth and survival of BRAFV600E human melanoma cells.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
22184411 2012 MicroRNA-27a/b controls endothelial cell repulsion and angiogenesis by targeting semaphorin 6A.
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
18187809 2008 From plasma membrane to cytoskeleton: a novel function for semaphorin 6A.
17671748 2007 Comparative integromics on non-canonical WNT or planar cell polarity signaling molecules: transcriptional mechanism of PTK7 in colorectal cancer and that of SEMA6A in undifferentiated ES cells.
16436660 2006 The class 6 semaphorin SEMA6A is induced by interferon-gamma and defines an activation status of langerhans cells observed in pathological situations.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
11242070 2001 Defining brain wiring patterns and mechanisms through gene trapping in mice.
10993894 2000 The orthologous human and murine semaphorin 6A-1 proteins (SEMA6A-1/Sema6A-1) bind to the enabled/vasodilator-stimulated phosphoprotein-like protein (EVL) via a novel carboxyl-terminal zyxin-like domain.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
9204478 1997 Cloning and expression of a novel murine semaphorin with structural similarity to insect semaphorin I.