Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.13
PubTator Score 8.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3163 4.0e-08
lung cancer 4473 2.8e-05
adult high grade glioma 2148 6.8e-05
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Globe disease 57 0.0 1.0

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -3.200 4.0e-08
lung cancer 1.900 2.8e-05
adult high grade glioma -1.100 6.8e-05

Gene RIF (3)

PMID Text
21925246 data seems to indicate that SEMA4F is involved in tumour progression in breast cancer
19056885 Sema4F levels were strongly reduced in a panel of human neurofibromas, confirming the relevance of these findings to the human disease.
11901358 Fine mapping of the chromosome 2p12-16 dyslexia susceptibility candidate gene

AA Sequence

MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVPHTYNYSVLLV      1 - 70
DPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKEDECHNFVQILAIANASHLLTC     71 - 140
GTFAFDPKCGVIDVSRFQQVERLESGRGKCPFEPAQRSAAVMAGGVLYAATVKNYLGTEPIITRAVGRAE    141 - 210
DWIRTDTLPSWLNAPAFVAAVALSPAEWGDEDGDDEIYFFFTETSRAFDSYERIKVPRVARVCAGDLGGR    211 - 280
KTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDI    281 - 350
RTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP    351 - 420
ADGHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLALFPEPQPVENM    421 - 490
KLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHAGEHRGLVQDIESADVSS    491 - 560
LCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQPSGVTALTPRRDGLEVVVTPGAMGAYACEC    561 - 630
QEGGAAHVVAAYSLVWGSQRDAPSRAHTVGAGLAGFFLGILAASLTLILIGRRQQRRRQRELLARDKVGL    631 - 700
DLGAPPSGTTSYSQDPPSPSPEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHIRLTGAPLATCDETSI    701 - 770
//

Text Mined References (22)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
22685421 2012 Genetic variants on chromosome 1q41 influence ocular axial length and high myopia.
21945643 2012 Expression of Semaphorin 4F in neurons and brain oligodendrocytes and the regulation of oligodendrocyte precursor migration in the optic nerve.
21925246 2011 Semaphorin-plexin signalling genes associated with human breast tumourigenesis.
21625861 2012 Comprehensive gene and microRNA expression profiling reveals the crucial role of hsa-let-7i and its target genes in colorectal cancer metastasis.
21136834 2008 Proteomic approaches to the analysis of atopic dermatitis and new insights from interactomics.
19056885 2008 NF1 loss disrupts Schwann cell-axonal interactions: a novel role for semaphorin 4F.
19047084 2008 Cancer-related axonogenesis and neurogenesis in prostate cancer.
16381901 2006 The LIFEdb database in 2006.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11901358 2002 Fine mapping of the chromosome 2p12-16 dyslexia susceptibility locus: quantitative association analysis and positional candidate genes SEMA4F and OTX1.
11483650 2001 Semaphorin4F interacts with the synapse-associated protein SAP90/PSD-95.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10051670 1999 Cloning, expression, and genetic mapping of Sema W, a member of the semaphorin family.
9856463 1998 Neuropilin-2 is a receptor for semaphorin IV: insight into the structural basis of receptor function and specificity.