Property Summary

NCBI Gene PubMed Count 80
PubMed Score 176.35
PubTator Score 155.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.800 4.4e-03
astrocytic glioma -1.800 4.0e-02
Astrocytoma, Pilocytic -2.300 1.2e-06
atypical teratoid / rhabdoid tumor -1.800 1.2e-05
diabetes mellitus -1.200 1.9e-02
ependymoma -2.100 3.8e-02
glioblastoma -1.800 2.8e-05
group 3 medulloblastoma -1.100 1.5e-02
intraductal papillary-mucinous carcinoma... 1.600 2.1e-04
intraductal papillary-mucinous neoplasm ... 1.900 9.0e-04
invasive ductal carcinoma 1.100 2.4e-02
lung cancer -1.100 1.1e-03
medulloblastoma, large-cell -2.800 5.3e-05
oligodendroglioma -1.400 3.3e-07
osteosarcoma -3.647 1.8e-06
Pick disease -1.600 5.6e-03
primary Sjogren syndrome 1.100 1.5e-02
primitive neuroectodermal tumor -1.700 2.7e-03
psoriasis -1.600 1.1e-04
subependymal giant cell astrocytoma -1.289 2.9e-02
ulcerative colitis 2.100 5.3e-07

Gene RIF (59)

AA Sequence

MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKDTLYIGAREAV      1 - 70
FAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLNL     71 - 140
TSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPS    141 - 210
FVFADVIRKSPDSPDGEDDRVYFFFTEVSVEYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLI    211 - 280
CSRPDSGLVFNVLRDVFVLRSPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQ    281 - 350
SHTKWVRYNGPVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY    351 - 420
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSSKKGNRFVYAG    421 - 490
SNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSRGLIQEMSGDASVCPDKSKGS    491 - 560
YRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPKYGLMGRKNLLIFNLSEGDSGVYQCLSEERV    561 - 630
KNKTVFQVVAKHVLEVKVVPKPVVAPTLSVVQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPK    631 - 700
PAPTGTSCEPKIVINTVPQLHSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSA    701 - 770
LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS    771 - 840
ARDKPFDVKCELKFADSDADGD                                                    841 - 862
//

Text Mined References (82)

PMID Year Title