Property Summary

NCBI Gene PubMed Count 16
PubMed Score 41.64
PubTator Score 26.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.400 1.2e-06
psoriasis 1.500 3.2e-04
osteosarcoma 2.317 5.5e-08
subependymal giant cell astrocytoma -1.080 2.3e-02
ovarian cancer 1.300 7.4e-04

Gene RIF (4)

PMID Text
25605244 Suggest that up-regulation of miR-125b or targeting Sema4C could serve as novel approaches to reverse chemotherapy resistance in breast cancers.
24142719 Data suggest that Erbin can interact with Sema4C, and co-expression of Erbin blocks the process of Sema4C-induced epithelial-mesenchymal transition.
22944267 There is a high expression of Sema4C in esophageal cancer, gastric cancer and rectal cancer, and expression is strongly correlated with lymphatic metastasis.
20959347 High Sema4C is associated with epithelial-mesenchymal transition and renal fibrosis.

AA Sequence

MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTEPTGLLYVGAR      1 - 70
EALFAFSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPYNASHLYVCGTYAFQPKCTYV     71 - 140
NMLTFTLEHGEFEDGKGKCPYDPAKGHAGLLVDGELYSATLNNFLGTEPIILRNMGPHHSMKTEYLAFWL    141 - 210
NEPHFVGSAYVPESVGSFTGDDDKVYFFFRERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLK    211 - 280
ARLACSAPNWQLYFNQLQAMHTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHE    281 - 350
EAQKWDRYTDPVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF    351 - 420
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQSKKLLFAGSRS    421 - 490
QLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQHVMTSDTSGICNLRGSKKVRP    491 - 560
TPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQPGSFLYDARLQALVVMAAQPRHAGAYHCFSE    561 - 630
EQGARLAAEGYLVAVVAGPSVTLEARAPLENLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKA    631 - 700
TERTLVYPLELPKEPTSPPFRPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPL    701 - 770
PSPTRLHLGGGRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV           771 - 833
//

Text Mined References (19)

PMID Year Title
25605244 2015 MiR-125b regulates epithelial-mesenchymal transition via targeting Sema4C in paclitaxel-resistant breast cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24142719 2013 Erbin interacts with Sema4C and inhibits Sema4C-induced epithelial-mesenchymal transition in HK2 cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22944267 2012 [Expression and clinical significance of Sema4C in esophageal cancer, gastric cancer and rectal cancer].
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
20959347 2011 Role of Sema4C in TGF-?1-induced mitogen-activated protein kinase activation and epithelial-mesenchymal transition in renal tubular epithelial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17498836 2007 Sema4C participates in myogenic differentiation in vivo and in vitro through the p38 MAPK pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11162505 2001 Semaphorin 4C, a transmembrane semaphorin, [corrected] associates with a neurite-outgrowth-related protein, SFAP75.
11134026 2001 Sema4c, a transmembrane semaphorin, interacts with a post-synaptic density protein, PSD-95.
10318831 1999 A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF.
9464278 1998 Molecular cloning and mapping of human semaphorin F from the Cri-du-chat candidate interval.
7656991 1995 Identification of a member of mouse semaphorin family.