Property Summary

NCBI Gene PubMed Count 30
PubMed Score 79.08
PubTator Score 33.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 1.300 7.5e-03
pancreatic cancer 2.700 1.5e-03
malignant mesothelioma -2.000 1.9e-06
astrocytic glioma -1.400 4.4e-02
psoriasis -3.100 5.7e-05
oligodendroglioma -1.300 3.3e-06
cystic fibrosis 3.185 1.5e-06
hereditary spastic paraplegia -1.800 8.8e-03
adrenocortical adenoma -1.761 1.1e-02
primary pancreatic ductal adenocarcinoma 3.056 1.6e-03
lung cancer 3.200 1.3e-06
colon cancer -1.500 2.1e-02
sarcoidosis 1.100 4.4e-03
group 3 medulloblastoma 1.900 3.3e-02
posterior fossa group A ependymoma 2.100 2.9e-07
pancreatic carcinoma 1.100 2.2e-02
aldosterone-producing adenoma -1.997 1.5e-02
inflammatory breast cancer -1.400 3.3e-03
lung carcinoma -2.800 7.0e-39
Pick disease -1.100 1.9e-02
progressive supranuclear palsy -1.200 4.2e-02
invasive ductal carcinoma -1.400 2.6e-02
ovarian cancer -4.500 2.9e-09
Gaucher disease type 1 -2.400 1.6e-02
pituitary cancer -1.700 1.4e-03
chronic rhinosinusitis -1.326 3.1e-02

Protein-protein Interaction (9)

Gene RIF (16)

PMID Text
26977026 SEMA3C plays a role in the progression of breast cancer and may positively influence breast cancer cell adhesion, invasion and proliferation, as well as being associated with grade of disease and estrogen receptor status.
26286962 Data show significant increases in semaphorin3C, 3D and their receptor neuropilin-2 in degenerate samples which were shown to contain nerves and blood vessels, compared to non-degenerate samples without nerves and blood vessels.
26032848 Increased levels of Sema3C protein may be associated with the progression of glioma tumor and have potential as a prognostic marker for outcome of glioma patients.
25910410 SEMA3C expression increased in the transition from normal to malignant breast lesions and correlated with microvessel density and tumour grade and is differentially regulated in the development of breast versus oral neoplasia.
25839327 Functional loss of semaphorin 3C and/or semaphorin 3D and their epistatic interaction with ret are critical to Hirschsprung disease liability.
25808871 p65-Sema3C, but not FR-sema3C, rendered A549 lung cancer cells resistant to serum deprivation, suggesting that previously reported protumorigenic activities of sema3C may be due to p65-Sema3C produced by tumor cells
25464848 Glioma stem cells preferentially secrete Sema3C and coordinately express PlexinA2/D1 receptors to activate Rac1/nuclear factor (NF)-kB signaling.
23666167 SEMA3C is a novel adipokine regulated by weight changes.
22924992 Capillary-like tubular formation was reduced by the addition of culture media of sema3C miRNA cells.
22899844 The role of the motoneuronal Sema3 code could be to set population-specific axon sensitivity to limb-derived chemotropic Sema3 proteins, therefore specifying stereotyped motor nerve trajectories in their target field.
19915008 cleavage of semaphorin 3C induced by ADAMTS1 promotes the migration of breast cancer cells, indicating that the co-expression of these molecules in tumors may contribute to the metastatic program
19666519 mutations in GATA6 are genetic causes of congenital heart diseases involving outflow tract defects, as a result of the disruption of the direct regulation of semaphorin 3C-plexin A2 signaling
17390026 sema3A and sema3C have opposite roles in neoplasm invasiveness and adhesion
15077297 S3C from macrophages and fibroblasts, which is selectively directed against sympathetic nerve fibers, could be one element responsible for reduced sympathetic innervation in rheumatoid arthritis tissue
12730958 human glioma cells express class 3 semaphorins and receptors for soluble and membrane-bound semaphorins, suggesting a possible role of the semaphorin/neuropilin system in the interactions of human malignant glioma with the nervous and immune systems.
12174914 correlation of gene expression with histopathological findings and clinical outcome in ovarian and breast cancer patients

AA Sequence

MAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGS      1 - 70
KDHILSLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLYVCGSGAFSPVCT     71 - 140
YLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMINEELFSGMYIDFMGTDAAIFRSLTKRNAVRT    141 - 210
DQHNSKWLSEPMFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKW    211 - 280
TTFLKARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFN    281 - 350
GPFAHKEGPNHQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLI    351 - 420
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELILEELEVFKNHAPITTMK    421 - 490
ISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCSRFYPTGKRRSRRQDVRHGNP    491 - 560
LTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQASIKWLLQKDKDRRKEVKLNERIIATSQGLLI    561 - 630
RSVQGSDQGLYHCIATENSFKQTIAKINFKVLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHS    631 - 700
EMQMINQYCKDTRQQHQQGDESQKMRGDYGKLKALINSRKSRNRRNQLPES                       701 - 751
//

Text Mined References (31)

PMID Year Title
26977026 2016 Expression of Semaphorin 3C in Breast Cancer and its Impact on Adhesion and Invasion of Breast Cancer Cells.
26286962 2015 Class 3 semaphorins expression and association with innervation and angiogenesis within the degenerate human intervertebral disc.
26032848 2015 High level of Sema3C is associated with glioma malignancy.
25910410 2015 The relationship between semaphorin 3C and microvessel density in the progression of breast and oral neoplasia.
25839327 2015 Functional loss of semaphorin 3C and/or semaphorin 3D and their epistatic interaction with ret are critical to Hirschsprung disease liability.
25808871 2015 Full-Length Semaphorin-3C Is an Inhibitor of Tumor Lymphangiogenesis and Metastasis.
25464848 2014 Sema3C promotes the survival and tumorigenicity of glioma stem cells through Rac1 activation.
23666167 2013 Semaphorin 3C is a novel adipokine linked to extracellular matrix composition.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22924992 2012 Semaphorin 3C is involved in the progression of gastric cancer.
22899844 2012 Motoneuronal Sema3C is essential for setting stereotyped motor tract positioning in limb-derived chemotropic semaphorins.
19915008 2010 The cleavage of semaphorin 3C induced by ADAMTS1 promotes cell migration.
19666519 2009 GATA6 mutations cause human cardiac outflow tract defects by disrupting semaphorin-plexin signaling.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
17390026 2007 Increased class 3 semaphorin expression modulates the invasive and adhesive properties of prostate cancer cells.
15609325 2005 Identification and validation of novel ERBB2 (HER2, NEU) targets including genes involved in angiogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15077297 2004 Increased prevalence of semaphorin 3C, a repellent of sympathetic nerve fibers, in the synovial tissue of patients with rheumatoid arthritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12730958 2003 Human malignant glioma cells express semaphorins and their receptors, neuropilins and plexins.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12174914 Correlation of MDR-1, nm23-H1 and H Sema E gene expression with histopathological findings and clinical outcome in ovarian and breast cancer patients.
9405678 1997 Identification of semaphorin E as a non-MDR drug resistance gene of human cancers.
9331348 1997 Neuropilin-2, a novel member of the neuropilin family, is a high affinity receptor for the semaphorins Sema E and Sema IV but not Sema III.
9168980 1997 Identification of human semaphorin E gene expression in rheumatoid synovial cells by mRNA differential display.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
7748561 1995 Murine semaphorin D/collapsin is a member of a diverse gene family and creates domains inhibitory for axonal extension.