Property Summary

NCBI Gene PubMed Count 37
PubMed Score 0.00
PubTator Score 62.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -2.170 1.0e-05
cutaneous lupus erythematosus -1.400 1.0e-03
group 4 medulloblastoma -1.500 4.6e-03
intraductal papillary-mucinous adenoma (... 1.300 8.9e-03
lung adenocarcinoma -1.100 7.2e-09
lung cancer 1.200 1.8e-03
lung carcinoma -1.400 1.3e-14
medulloblastoma, large-cell -1.500 6.0e-04
non-small cell lung cancer -1.569 1.1e-17
ovarian cancer -1.600 2.0e-05
pediatric high grade glioma -1.100 6.8e-03
posterior fossa group A ependymoma 1.300 1.0e-04
progressive supranuclear palsy -1.200 2.8e-02
psoriasis -1.400 2.9e-03
subependymal giant cell astrocytoma -1.045 2.0e-02

Gene RIF (29)

AA Sequence

MGRAGAAAVIPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYQALLVDEERGRLFVG      1 - 70
AENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLLHAYNRTHLLACGTGAFHPTC     71 - 140
AFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVLVGEELYSGVAADLMGRDFTIFRSLGQRPSL    141 - 210
RTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLV    211 - 280
NKWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRA    281 - 350
FLGPFAHKEGPMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPTGGRPL    351 - 420
FLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTS    421 - 490
MQISSKRHQLYVASRSAVAQIALHRCAAHGRVCTECCLARDPYCAWDGVACTRFQPSAKRRFRRQDVRNG    491 - 560
DPSTLCSGDSSRPALLEHKVFGVEGSSAFLECEPRSLQARVEWTFQRAGVTAHTQVLAEERTERTARGLL    561 - 630
LRRLRRRDSGVYLCAAVEQGFTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGG    631 - 700
GGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATHW                         701 - 749
//

Text Mined References (38)

PMID Year Title