Property Summary

NCBI Gene PubMed Count 33
PubMed Score 0.00
PubTator Score 62.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 1.0e-03
psoriasis -1.800 1.7e-42
group 4 medulloblastoma -1.500 4.6e-03
medulloblastoma, large-cell -1.500 6.0e-04
adrenocortical carcinoma -2.170 1.0e-05
non-small cell lung cancer -1.569 1.1e-17
intraductal papillary-mucinous adenoma (... 1.300 8.9e-03
lung cancer 1.200 1.8e-03
lung adenocarcinoma -2.100 9.2e-06
pediatric high grade glioma -1.100 6.8e-03
posterior fossa group A ependymoma 1.300 1.0e-04
subependymal giant cell astrocytoma -1.045 2.0e-02
lung carcinoma -1.400 1.3e-14
progressive supranuclear palsy -1.200 2.8e-02
ovarian cancer -1.600 2.0e-05

Gene RIF (25)

PMID Text
25961819 Aberrant expression and methylation of SEMA3B could be suggested as markers of lung and renal cancer progression.
25454475 SEMA3B mRNA and protein is not altered in severe early onset preeclamptic placentas.
25335892 although plexin-A4 overexpression restored Sema3A signaling in plexin-A1-silenced cells, it failed to restore Sema3B signaling in plexin-A2-silenced cells.
24402303 CpG methylation of SEMA3B epigenetically regulates SEMA3B expression during development of gastric cancer.
24280143 The transcriptional activity of RHOA, SEMA3B, and CKAP2 genes was assessed in blood samples of leukaemia patients and healthy donors.
23906303 Loss of Sema3B expression is associated with biochemical recurrence of patients with low- and intermediate-risk prostate cancer.
23292452 Three candidate tumor-suppressor genes, SEMA3B, AXUD1 and GNAT1 may be involved in oral squamous cell carcinoma.
20124444 semaphorin-3B and semaphorin-3F have roles in ovarian cancer
20088387 that methylation of promoter CpG-island contributed into inactivation of SEMA3B gene-suppressor in RCC.
19683737 These data indicate that polymorphisms in SEMA3B are associated with prostate cancer risk and poor prognosis in Hispanic and nonHispanic white men
19683737 Observational study of gene-disease association. (HuGE Navigator)
19548530 SEMA3B plays role in inhibiting of growth of renal, ovarian and colorectal cancer cells.
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18985860 IGFBP-6 is the effector of tumor suppressor activity of SEMA3B.
18922901 SEMA3B is a potential tumor suppressor that induces apoptosis in SEMA3B-inactivated tumor cells through the Np-1 receptor by inactivating the Akt signaling pathway.
18757406 Repulsion of human umbilical vascular endothelial cells by sema3B-m was mediated primarily by the neuropilin-1 receptor but sema3B-m was also able to transduce signals via neuropilin-2
18458115 SEMA3B exerts unexpected functions in cancer progression by fostering a prometastatic environment through elevated IL-8 secretion.
18356290 A putative role for SEMA3B as an osteoblast protein that regulates bone mass and skeletal homeostasis.
17452250 Higher level of SEMA3B expression was found in differentiated tumors with favorable histopathology (n = 19) than in tumors with unfavorable histology.
15831529 Observational study of gene-disease association. (HuGE Navigator)
15831529 Heterozygous or homozygous variant genotype confers a >40% reduced relative risk of lung cancer in Latino Americans controlling for other lung cancer risk factors.
15273288 VEGF165, produced by tumor cells, acts as an autocrine survival factor and that SEMA3B mediates its tumor-suppressing effects, at least in part, by blocking this VEGF autocrine activity.
12810670 SEMA3B gene alterations may play a important role in the malignant transformation of NSCLC via a two-hit mechanism, including epigenetic changes and allelic loss, for tumor suppressor gene inactivation.
11922394 Identification of semaphorin 3B as a direct target of p53.
11809707 Human Semaphorin 3B (SEMA3B) located at chromosome 3p21.3 suppresses tumor formation in an adenocarcinoma cell line.

AA Sequence

MGRAGAAAVIPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYQALLVDEERGRLFVG      1 - 70
AENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLLHAYNRTHLLACGTGAFHPTC     71 - 140
AFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVLVGEELYSGVAADLMGRDFTIFRSLGQRPSL    141 - 210
RTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLV    211 - 280
NKWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRA    281 - 350
FLGPFAHKEGPMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPTGGRPL    351 - 420
FLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTS    421 - 490
MQISSKRHQLYVASRSAVAQIALHRCAAHGRVCTECCLARDPYCAWDGVACTRFQPSAKRRFRRQDVRNG    491 - 560
DPSTLCSGDSSRPALLEHKVFGVEGSSAFLECEPRSLQARVEWTFQRAGVTAHTQVLAEERTERTARGLL    561 - 630
LRRLRRRDSGVYLCAAVEQGFTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGG    631 - 700
GGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATHW                         701 - 749
//

Text Mined References (34)

PMID Year Title
25961819 2015 Tumor Suppressor Function of the SEMA3B Gene in Human Lung and Renal Cancers.
25454475 2014 Placental SEMA3B expression is not altered in severe early onset preeclampsia.
25335892 2014 The role of the plexin-A2 receptor in Sema3A and Sema3B signal transduction.
24402303 2014 Analysis of SEMA3B methylation and expression patterns in gastric cancer tissue and cell lines.
24280143 2013 RHOA, SEMA3B, and CKAP2 expression in leukaemia of different types: the results of a pilot experiment.
23906303 2013 The predictive value of semaphorins 3 expression in biopsies for biochemical recurrence of patients with low- and intermediate-risk prostate cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23292452 2013 Screening of candidate tumor-suppressor genes in 3p21.3 and investigation of the methylation of gene promoters in oral squamous cell carcinoma.
20124444 2010 Hormonal regulation and distinct functions of semaphorin-3B and semaphorin-3F in ovarian cancer.
20088387 [Two CpG-islands of SEMA3B gene: methylation in clear cell renal cell carcinoma].
19683737 2009 Semaphorin 3B and 3F single nucleotide polymorphisms are associated with prostate cancer risk and poor prognosis.
19548530 [Alteration of SEMA3B gene expression levels in epithelial tumors].
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
18985860 2008 Identification of IGFBP-6 as an effector of the tumor suppressor activity of SEMA3B.
18922901 2008 Semaphorin 3B inhibits the phosphatidylinositol 3-kinase/Akt pathway through neuropilin-1 in lung and breast cancer cells.
18757406 2008 Semaphorin-3B is an angiogenesis inhibitor that is inactivated by furin-like pro-protein convertases.
18458115 2008 The tumor suppressor semaphorin 3B triggers a prometastatic program mediated by interleukin 8 and the tumor microenvironment.
18356290 2008 Semaphorin 3B is a 1,25-Dihydroxyvitamin D3-induced gene in osteoblasts that promotes osteoclastogenesis and induces osteopenia in mice.
17452250 2007 High-resolution analysis of 3p deletion in neuroblastoma and differential methylation of the SEMA3B tumor suppressor gene.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15831529 2005 The race associated allele of Semaphorin 3B (SEMA3B) T415I and its role in lung cancer in African-Americans and Latino-Americans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273288 2004 Semaphorin 3B (SEMA3B) induces apoptosis in lung and breast cancer, whereas VEGF165 antagonizes this effect.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12810670 2003 Allelic loss on chromosome 3p21.3 and promoter hypermethylation of semaphorin 3B in non-small cell lung cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11922394 Identification of semaphorin3B as a direct target of p53.
11809707 2002 Human Semaphorin 3B (SEMA3B) located at chromosome 3p21.3 suppresses tumor formation in an adenocarcinoma cell line.
11717452 2001 Inhibition of lung cancer cell growth and induction of apoptosis after reexpression of 3p21.3 candidate tumor suppressor gene SEMA3B.
11085536 2000 The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes. The International Lung Cancer Chromosome 3p21.3 Tumor Suppressor Gene Consortium.
10196546 1998 Semaphorins A and E act as antagonists of neuropilin-1 and agonists of neuropilin-2 receptors.
8633026 1996 Human semaphorins A(V) and IV reside in the 3p21.3 small cell lung cancer deletion region and demonstrate distinct expression patterns.
8603390 1996 Construction of a 600-kilobase cosmid clone contig and generation of a transcriptional map surrounding the lung cancer tumor suppressor gene (TSG) locus on human chromosome 3p21.3: progress toward the isolation of a lung cancer TSG.
7748561 1995 Murine semaphorin D/collapsin is a member of a diverse gene family and creates domains inhibitory for axonal extension.