Property Summary

NCBI Gene PubMed Count 46
PubMed Score 645.55
PubTator Score 170.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.500 9.4e-05
non-small cell lung cancer 1.009 2.3e-19
Pneumonia -1.800 1.9e-03
sonic hedgehog group medulloblastoma 1.100 2.4e-04
subependymal giant cell astrocytoma 1.080 1.5e-02

Synonym

Accession P60896 Q13437 Q61067
Symbols ECD
DSS1
SHFD1
SHFM1
SHSF1
Shfdg1
C7orf76

Gene

PDB

5GJQ   5GJR   5LN3   5M32   5T0C   5T0G   5T0H   5T0I   5T0J   5VGZ   5VHF   5VHH   5VHI   5VHS   5L4K   1IYJ   1MIU   1MJE   3T5X  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (21)

AA Sequence

MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS      1 - 70
//

Text Mined References (52)

PMID Year Title