Property Summary

NCBI Gene PubMed Count 46
PubMed Score 645.55
PubTator Score 170.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.500 9.4e-05
non-small cell lung cancer 1.009 2.3e-19
Pneumonia -1.800 1.9e-03
sonic hedgehog group medulloblastoma 1.100 2.4e-04
subependymal giant cell astrocytoma 1.080 1.5e-02

Synonym

Accession P60896 Q13437 Q61067
Symbols ECD
DSS1
SHFD1
SHFM1
SHSF1
Shfdg1
C7orf76

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

PDB (19)

Gene RIF (21)

AA Sequence

MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS      1 - 70
//

Text Mined References (52)

PMID Year Title