Property Summary

NCBI Gene PubMed Count 178
PubMed Score 2781.00
PubTator Score 1483.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Amyotrophic Lateral Sclerosis 432 0.0 1.0

Expression

  Differential Expression (25)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.974 1.6e-02
astrocytic glioma 1.800 4.1e-02
oligodendroglioma 3.000 9.0e-03
uncontrolled asthma -1.200 1.5e-02
cutaneous lupus erythematosus 4.000 1.2e-04
osteosarcoma -2.911 1.4e-02
glioblastoma 1.100 2.0e-02
periodontitis 1.500 2.9e-30
tuberculosis 1.700 2.2e-05
non-small cell lung cancer -1.623 4.6e-11
intraductal papillary-mucinous carcinoma... -1.400 1.2e-02
lung cancer -3.600 1.7e-04
interstitial cystitis 2.800 6.7e-05
adult high grade glioma 1.200 2.7e-02
pilocytic astrocytoma 1.300 1.6e-03
primary Sjogren syndrome 3.100 7.1e-06
psoriasis 2.300 7.2e-105
invasive ductal carcinoma 1.700 4.8e-02
lung carcinoma -2.600 6.3e-20
ductal carcinoma in situ 2.100 2.3e-02
acute myeloid leukemia -2.400 1.5e-02
ulcerative colitis 3.700 1.7e-06
ovarian cancer -2.500 3.6e-09
pituitary cancer -2.600 4.7e-05
dermatomyositis 1.600 3.4e-02

 IMPC Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (171)

PMID Text
26852488 Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria
26693907 freeze and thaw of murine and human Tregs is associated with reduced expression of L-selectin (CD62L), which was previously established to be an important factor that contributes to the in vivo protective effects of Tregs
26361072 While total surface expression of CD11b and L-selectin on neutrophils was largely unaffected
26329844 Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level.
26162407 Functional analyses revealed that the lymphocyte homing receptor L-selectin (CD62L) is the key factor controlling the binding of chronic lymphocytic leukemia cells to high endothelial venule walls in vivo.
25822027 Both Nef and Vpu associated with and sequestered CD62L in perinuclear compartments, thereby impeding CD62L transport to the plasma membrane.
25822027 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells
25618296 These data confirm the expression of CD62L on urothelial carcinoma cells and suggest that CD62L may serve as biomarker to predict the presence of or risk for developing metastatic disease in patients with bladder cancer.
25576479 Variants within the SELL gene are associated with sL-selectin levels. Despite accounting for a significant portion of the protein level variance, none of the variants was associated with clinical or subclinical cardiovascular disease.
25498912 ST3Gal-4 is the primary sialyltransferase regulating the synthesis of E-, P-, and L-selectin ligands on human myeloid leukocytes
25330112 Here we report that HIV-1 down-modulates CD62L in productively infected naive and memory resting CD4 T cells while suppressing Foxo1 activity and the expression of KLF2 mRNA.
25275127 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells
25209910 the polymorphisms within L-selectins gene were not associated with Visceral leishmaniasis and it may be concluded that these genotypes and alleles are unable to affect immune responses in Visceral leishmaniasis patients
25095634 Individuals who undertake physical activity regularly, benefit from each single physical effort, because of decrease in serum concentration of proinflammatory molecules such as L-selectin and P-selectin.
24829027 Increased expression of L-selectin ligands may be involved in the implantation process in tubal pregnancy.
24667918 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells
24631064 in a large, multiethnic population, soluble L-selectin levels did not predict clinical or subclinical cardiovascular disease
24606340 P-selectin glycoprotein ligand-1 and L-selectin have roles in neutrophil recruitment and activate human endothelial colony-forming cells at the site of vessel injury
24595810 results indicate a regulatory influence of MR signaling on human T-cell migration and suggest a role for endogenous aldosterone in the redistribution of T-cell subsets to lymph nodes, involving CD62L, CCR7, and CXCR4.
24516598 Concentrations of intercellular adhesion molecule (ICAM) -1, E-selectin, L-selectin, and P-selectin in serum samples from patients with systemic sclerosis were measured.
24399259 SELL rs7531806 and rs1060573 are involved in androgen metabolism, inflammation processes and scar formation in severe acne.
24127491 The PSGL-1-L-selectin complex-induced signaling effects on neutrophil slow rolling and recruitment in vivo demonstrate the functional importance of this pathway.
23927766 A cellular model system for quantifying L-selectin adhesion mechanics, is described.
23925765 Cell-based assessment of the percentage of L-selectin-expressing CD4 T cells could provide an urgently needed biomarker for individual risk assessment of progressive multifocal leukoencephalopathy (PML).
23796515 Molecular basis for the moesin/l-selectin/CaM ternary complex; an important role for phospholipids in modulating l-selectin function and shedding.
23658780 the association of calmodulin with L-selectin
23573259 Coronary artery disease patients blood samples showed a significantly higher L-selectin, but not CD11b response to TLR stimulation than controls.
23571167 the association between expression of the adhesion molecule CD62L (L-selectin) on naive and central memory T cells and the formation of antigen-specific antibodies differed significantly between younger and elder donors.
23487023 Over-activation of ADAM17 in NK cells may be detrimental to their effector functions by down-regulating surface expression of CD16 and CD62L.
23442851 In contrast to P- and L-selectin, the E-selectin/PSGL-1 binding does not exhibit significant changes at acidic pH levels, as shown both experimentally and computationally.
23319734 ATP induces CD62L downregulation from the surface of naive CD4+ T lymphocytes through the P2X7 receptor.
23028631 association between L-selectin concentrations in plasma and skin damage in patients with systemic sclerosis
22977256 Native glycodelin-A binds to peripheral blood monocytes inducing interleukin-6 secretion through L-selectin.
22941246 a unique lymphoid-primed population in human bone marrow was generated from hematopoietic stem cells before onset of expression of CD10 and commitment to the B cell lineage identified by high expression of the homing molecule L-selectin (CD62L).
22921892 P213S polymorphism of the L-selectin gene is associated with type 2 diabetes and insulin resistance.
22842622 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells
22836626 study found a progressive increase in the concentrations of E-selectin, P-selectin and L-selectin with severity of obstructive sleep apnea (OSA); level of plasma adhesion molecules may be indicative of OSA severity and may contribute to cardiovascular sequelae
22627390 determination of critical patch lengths of P-and L-selectin for the initiation of HL-60 cell binding in shear flow
22159147 Data indicate that MUC16 immunopurified from pancreatic cancer cells efficiently binds E- and L- but not P-selectin.
22119815 No statistically significant results were found in order to sustain the hypothesis of association between SELL gene P213S polymorphism, type 2 diabetes mellitus and end stage renal disease.
22068558 Data suggest that up-regulation of plasma selectins (selectin E, selectin L, and selectin P) may represent novel mechanism of aldosterone-mediated development/progression of atherosclerosis.
21869829 Pretreatment of cardiac mesoangioblasts with SDF-1 or transient expression of L-selectin induced a two- to three-fold increase in their transmigration and homing to the damaged heart.
21664913 These results suggest that the association of CaM with L-selectin in the cell can be influenced by the membrane bilayer and that anionic lipids may modulate ectodomain shedding of transmembrane receptors.
21584225 Lower frequency of CD62L(high) and higher frequency of TNFR2(+) Tregs are associated with inflammatory conditions in type 1 diabetic patients.
21546114 [review] Distinct domains of L-selectin contribute to proper leukocyte migration out of the vasculature into surrounding tissues during inflammation and immune surveillance.
21521525 SELP, but not SELE or SELL, are risk factors for age-related macular degeneration; sporadic or rare mutations in SELE, SELL, or SELP may have a role in the pathogenesis of AMD
21484243 Levels of P-selectin and L-selectin were decreased in AD and lowest in AD patients with highest cognitive decline. Our findings suggest that these molecules may induce alterations of endothelial regulation and influence neurodegenerative processes of AD
21465128 L-selectin gene may play a role in the development of ischemic stroke.
21316337 Data show that L-selectin TM and cytoplasmic domains lack the ability to dimerize in cell membranes.
21237580 Results indicate that the primary pro-inflammatory cytokine TNF-alpha regulates the L-selectin surface expression on neutrophils after surgical trauma.
21197561 The sLeX/L-selectin adhesion system at fetal-maternal interface not only mediates the adhesion of embryo to uterine epithelium, but also effectively induces the apoptosis in uterine epithelium.
20925194 These results indicate that nuclear NFAT can activate CSF-1 gene transcription by connecting with the CSF-1 promoter in the signaling events induced by L-selectin ligation.
20708610 Cell count and CD62L expression were predictive for a positive culture and the combination helped to increase specificity and sensitivity for the detection of ventriculitis in blood-containing cerebrospinal fluid.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20580062 Letter: P-selectin was found in amniotic fluid and cord blood.
20507883 TyrSO(3) residues in association with a C2-SLe(x) moiety within endoglycan and PSGL-1 are preferentially recognized by L-selectin.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20469932 Analyzed the site-specific N-glycosylation of the lectin and EGF-like domain of L-selectin using recombinant variants ("LEHis").
20306662 Data show that a significant increase in CD62L in HCV-positive patients compared to HCV-negative ones.
20220571 Observational study of gene-disease association. (HuGE Navigator)
20212041 TM domains of L-selectin and CD44 play a crucial role in cell adhesion under flow by targeting receptors to microvilli or the cell body, respectively.
20193033 Data show a significant decrease in L-selectin and increased E-selectin and ICAM-1 expression in HH patients.
20065025 This effect of AgC10 is likely due to its ability to induce L-selectin shedding from the monocyte membrane, since pharmacologic blocking of this shedding prevents AgC10 activity.
19954409 Data show that ICAM-1 levels are significantly higher in thrombocytopenia and thrombocytosis compared to control, while L-selectin levels are significantly higher in thrombocytopenia.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19837408 Ang II down-regulated CD62L from the surface of human neutrophils, a process which was independent of neutrophil adhesion to endothelium
19670701 Expression of selectins (E and L) was detected mainly in the skin leukocytes in all biopsy samples of dermatitis herpetiformis and bullous pemphigoid.
19654311 BCR signaling promotes decrease of CXCR4 and CD62L membrane expression in progressive cases only.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19462221 expression on donor cells increases risk of acute graft-versus-host disease after allogeneic blood and marrow transplantation
19419934 The purpose of the study was to evaluate the percentage of CD4+/CD8+ peripheral T cells expressing CD62L+ and CD54+ in patients with Graves' disease.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240957 Despite the fact that selectins play a role in the pathogenesis of MS and their encoding genes are located in regions associated with the disease, the selectin gene cluster studied likely does not influence the susceptibility to MS in Caucasians.
19240957 Observational study of gene-disease association. (HuGE Navigator)
19212205 Results showed an association of inflammatory bowel disease with allele L206 of L-selectin gene, whereas genotype L/F was associated with a subgroup of UC (left-sided type) and CD patients with more extensive location of disease and stricturing behavior
19212205 Observational study of gene-disease association. (HuGE Navigator)
19129194 In Vitro and in Vivo Characterization of Molecular Interactions between Calmodulin, Ezrin/Radixin/Moesin, and L-selectin
19118161 Podocalyxin-like protein is an E-/L-selectin ligand on colon carcinoma cells: comparative biochemical properties of selectin ligands in host and tumor cells.
19088176 Dermatan sulfate proteoglycan biglycan is a potential selectin L/CD44 ligand involved in tethering/rolling of peripheral blood CD16(-) NK cells on endometrial microvascular endothelial cells.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
19052753 Fibromyalgia patients showed a significantly decreased expression of CD62L on neutrophils.
18974842 Observational study of gene-disease association. (HuGE Navigator)
18973547 There was a significant difference in the Ser128Arg polymorphism of E-selectin, but not in the L-selectin polymorphism, between periodontal patients and controls.
18829897 Inhibition of Na+/H+ exchanger enhances low pH-induced L-selectin shedding and beta2-integrin surface expression in human neutrophils.
18713968 FOXO1 controls the expression of L-selectin and EDG1 and EDG6, receptors that regulate lymphocyte trafficking
18713749 the role of PSLG1 decamers is to extend PSGL-1 N terminus far above the cell surface to support and stabilize leukocyte rolling on L- or P-selectin
18665829 There was no association between L-Selectin gene polymorphisms and high expression of L-selectin by leukocytes, or the development of complications in Sickle cell disease
18619508 nuclear c-Abl kinase can activate CSF-1 gene transcription by regulating AP-1 activity in the signaling events induced by L-selectin ligation.
18582506 different reactivity causes different temporal characteristics between CD62L+ and CD62L- lymphocyte subsets found in acute psychological stress
18496641 Diabetic microangiopathy is accompanied by increase in CD11b expression and decrease in CD62L expression on peripheral blood neutrophils.
18385135 The binding of head and neck squamous cancer cells to L-selectin displays canonical biochemical features, but displays a novel operational shear threshold differing from all other L-selectin ligands
18375392 CEA and CD44v cooperate to mediate colon carcinoma cell adhesion to E- and L-selectin at elevated shear stresses.
18250165 a lectin domain residue in L-selectin has a role in binding to P-selectin glycoprotein ligand-1 but not to 6-sulfo-sialyl Lewis x
18191640 Data show that P-selectin, but not L- or E-selectin, concentrations are significantly increased in male and female pseudoxanthoma elasticum patients.
18182036 Observational study of gene-disease association. (HuGE Navigator)
18089680 Populations of CD4+ T cells were examined on the basis of the expression of CD62L, CCR7 and CXCR5 in patients with systemic lupus erythematosus in relation to CCL21 and CXCL10.
18032547 In various renal diseases, l-selectin and MCP-1 binding to interstitial perivascular matrix HSPGs is increased, which is significantly associated with leukocyte influx.
18028430 L-selectin is defective in the stem cell compartment of MDS and sAML, whereas ICAM1 is overexpressed; the ratio of their expression has a prognostic role; and a ratio <1 significantly predicts progression to overt leukaemia in MDS patients
17954174 Observational study of gene-disease association. (HuGE Navigator)
17890399 A new method for determining receptor-ligand association/dissociation events across the interface of two surfaces (two-dimensional binding) by monitoring abrupt decrease/resumption in thermal fluctuations of a biomembrane force probe.
17765649 Aphanizomenon flos water extract contains a novel ligand for CD62L. It modulates CXCR4 expression on CD34+ bone marrow cells in vitro and triggers stem cell mobilization in vivo.
17706337 In women with subsequent preeclampsia, sL-selectin and sVCAM-1 concentrations were significantly lower, whereas sE-selectin, sP-selectin and sICAM-1 levels were significantly higher, compared with controls at mid-pregnancy (p<0.05).
17703412 Observational study of gene-disease association. (HuGE Navigator)
17698668 Capture and eventual transfer of such CD62L-bearing virions by the endothelium could play a role in the pathogenesis of HIV-1 infection.
17525255 Data show that upon experimental and human renal ischemia/reperfusion, microvascular basement membrane (BM) heparan sulfate proteoglycans (collagen 18alpha1, agrin and perlecan) are modified to bind L-selectin and monocyte chemoattractant protein-1.
17515951 Data show that in bullous pemphigoid, expression of L selectins was detected mainly in basal keratinocytes and in inflammatory infiltrates in the dermis.
17465998 Observational study of gene-disease association. (HuGE Navigator)
17465998 L-selectin gene polymorphisms are associated with GD susceptibility.
17407075 Findings suggest that L-selectin gene 213P mutant allele might contribute to susceptibility of Chinese individuals to contract coronary heart disease.
17407075 Observational study of gene-disease association. (HuGE Navigator)
17056762 We found that signaling through CD62L up-regulated FasL.
17055225 B cells from Bullous pemphigoid patients showed decreased expression of L-selectin
17028146 flow-enhanced cell tethering is governed through L-selectin at threshold shear
16982492 Observational study of gene-disease association. (HuGE Navigator)
16974056 Observational study of gene-disease association. (HuGE Navigator)
16974056 The interval was significantly longer in IgA nephropathy patients with a homoallele of C in C1402T, C1402/C1402, of the E-selectin gene, or a homoallele of C in C712T, C712/C712, of the L-selectin gene compared to others.
16916660 Observational study of genotype prevalence. (HuGE Navigator)
16740600 shedding of CD21 and CD62L is mediated via the P2X7R.
16738933 A potential role of the L selectin SNPs in the pathogenesis of inflammatory diseases, including IgA nephropathy was shown.
16690519 CD62L and CCR7, as well as dendritic cells, are reduced in non-Hodgkin's lymphoma
16585636 Observational study of gene-disease association. (HuGE Navigator)
16585636 higher frequency of L-selectin genotypes in patients with brucellosis than in controls & the association between the 206Leu allele & the occurrence of brucellosis relapse, suggest the F206L polymorphism may make individuals more vulnerable to brucellosis
16565092 expression of HCELL confers robust and predominant tumor cell binding to E- and L-selectin
16357481 Observational study of gene-disease association. (HuGE Navigator)
16357481 The 206Leu allele frequency occurred in 42% of the patients with coronary artery disease compared to 30% of the controls (p<0.009).
16352650 variant isoforms of CD44 on LS174T colon carcinoma cells possess selectin binding activity, in contrast to the standard isoform of CD44 on hematopoietic-progenitor cells.
16270299 Serum levels were measured with enzyme-linked immunosorbent assays over the first 2 years of life in 65 children seroconverting to positivity for autoantibodies and 65 control children, all with susceptibility to type 1 diabetes.
15831305 Increased expression of L-selectin ligand in the human endometrium during the early and midsecretory phases of the menstrual cycle may be related to the process of implantation.
15776384 There was significantly more soluble L-selectin in serum samples from subjects with cryptococcosis than in those from uninfected subjects
15506984 describes currently known binding partners of the L-selectin tail and how their associations affect L-selectin function. (review)
15470072 L-selectin plays a role in the vascular homing of peripheral blood-derived endothelial progenitor cells.
15192100 L-selectin signal transduction requires protein kinase C alpha, iota, and theta binding
15178693 results suggest that ezrin-radixin-moesin proteins are required for microvillar positioning of L-selectin and that this is important both for leukocyte tethering and L-selectin shedding
15093751 LSEL expression is increased by biochemical engineering of sialic acids.
14737745 positive marker for precinical type 1 diabetes in children
14615387 L-selectin mediates adhesion at all shear rates. Mocyte-expressed L-selectin functionally mediates primary tethering of monocytes to endothelial-cell ccarbohydrate ligands. L-selectin blockade without PMCs had an inhibitory effect on monocyte adhesion.
14597772 L-selectin tethers appear adapted to undergo rapid avidity enhancement by cellular transport, a specialized mechanism not used by any other known adhesion receptor.
14585903 Importance of CD62L expression on lymphocytes for recurrent miscarriage and the relevance of the maternal response to microbial antigens during pregnancy should be further explored.
14576059 engagement of both CD4 and CXCR4 is required for HIV-induced shedding of L-selectin on primary resting CD4(+) T cells.
14576059 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells
14533031 Strong relationship between soluble L-selectin and diabetic retinopathy. strong correlation between sL-selectin and HbA1c. Soluble L-selectin is increased with poor glycemic control.
12918706 expression on leukocytes in Behcet's disease.
12874338 Anaplasma phagocytophilum infected neutrophils showed reduced expression of P-selectin glycoprotein ligand 1 (PSGL-1, CD162) and L-selectin (CD62L)
12871600 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12844406 Monitoring of the plasma level of sL-selectin is possibly useful for early diagnosis of relapse and extramedullary infiltration in acute leukemia.
12738381 interacts with Helicobacter pylori isolates from patients with chronic gastritis, duodenal ulcer and gastric cancer
12736247 L-selectin binds with high affinity to the N-terminal region of PSGL-1 through cooperative interactions with three sulfated tyrosine residues and an appropriately positioned C2-O-sLex O-glycan.
12609846 L-selectin mobilized intracellular CXCR4 to significantly increase surface CXCR4 stimulation and inhibited SDF-1 induced CXCR4 internalization.
12595908 Observational study of gene-disease association. (HuGE Navigator)
12532021 results suggest that trophoblast L-selectin mediates interactions with the uterus and that this adhesion mechanism may be critical to establishing human pregnancy
12496379 L-selectin is expressed in memory CD4+ T cells that are smaller, proliferate well in response to tetanus toxoid, have longer telomeres, and express genes and proteins consistent with immune surveillance function.
12431911 that L-selectin was colocalized with high-affinity CD18.Adhesion signaled via L-selectin coincided with the kinetics of MAPK phosphorylation and was inhibited by blocking p38 or p42/44 activity.
12370391 L-selectin initiates leukocyte/endothelial cell interactions leading to leukocyte rolling and migration which are then optimized by CD18 integrin/ICAM-1 cooperative interactions.
12202158 data provide a comprehensive comparison of the L-selectin/cytoskeletal interaction with other functionally important surface antigens
12200386 Conjunctival biopsies excised from patients following cataract surgery provided circumstantial evidence that endothelial L-selectin might play a role in the surgery-induced up-regulation of leukocyte rolling.
12200076 Protein polymorphism is associated with diabetic nephropathy in type 2 diabetes mellitus
12186696 circulating soluble selectitn L in acute myeloid leukemia is correlaed with peripheral blast cell counts, extramedullaary infiltration, relapse and mortality
12165498 CD62L on human cultured T lymphoblasts is one of several glycoproteins that interacts directly with E-selectin and contributes to rolling under flow.
12147693 Data show that tumor necrosis factor-alpha-converting enzyme (TACE)is involved in the shedding of L-selectin by NSAIDS in human neutrophils.
12144128 review of structure, function, cell and tissue distribution
12063026 does not play a role in homing and clonogenic outgrowth of CD34(+) peripheral blood stem cells
12042326 destabilization of L-selectin-mediated lymphocyte rolling by endothelial chemokines
11907045 L-selectin dimerization enhances tether formation to properly spaced ligand.
11828340 Observational study of gene-disease association. (HuGE Navigator)
11828340 two SNPs in the E-selectin gene and six SNPs in the L-selectin gene were significantly associated with IgAN in Japanese patients
11821431 interacts with oversulfated chondroitin/dermatan sulfates containing GlcAbeta1/IdoAalpha1-3GalNAc(4,6-O-disulfate)
11466384 The cytoplasmic domain of L-selectin regulates shedding by a mechanism in which bound calmodulin may operate as a negative effector.
11064106 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
10449768 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells

AA Sequence

MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNK      1 - 70
AEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAG     71 - 140
KWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDC    141 - 210
THPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFS    211 - 280
FTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAF    281 - 350
IIWLARRLKKGKKSKRSMNDPY                                                    351 - 372
//

Text Mined References (182)

PMID Year Title
26852488 2015 [Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria].
26693907 2015 Freeze and Thaw of CD4+CD25+Foxp3+ Regulatory T Cells Results in Loss of CD62L Expression and a Reduced Capacity to Protect against Graft-versus-Host Disease.
26361072 2015 Human neutrophil antigen-3a antibodies induce neutrophil stiffening and conformational activation of CD11b without shedding of L-selectin.
26329844 2015 Distinct kinetic and mechanical properties govern mucin 16- and podocalyxin-mediated tumor cell adhesion to E- and L-selectin in shear flow.
26162407 2015 L-selectin controls trafficking of chronic lymphocytic leukemia cells in lymph node high endothelial venules in vivo.
25982478 2015 A novel splice variant of human L-selectin encodes a soluble molecule that is elevated in serum of patients with rheumatic diseases.
25822027 2015 HIV-1 Nef and Vpu Interfere with L-Selectin (CD62L) Cell Surface Expression To Inhibit Adhesion and Signaling in Infected CD4+ T Lymphocytes.
25618296 2015 Increased expression of L-selectin (CD62L) in high-grade urothelial carcinoma: A potential marker for metastatic disease.
25576479 2015 Multi-ethnic analysis reveals soluble L-selectin may be post-transcriptionally regulated by 3'UTR polymorphism: the Multi-Ethnic Study of Atherosclerosis (MESA).
25498912 2015 ST3Gal-4 is the primary sialyltransferase regulating the synthesis of E-, P-, and L-selectin ligands on human myeloid leukocytes.
25330112 2014 Suppression of Foxo1 activity and down-modulation of CD62L (L-selectin) in HIV-1 infected resting CD4 T cells.
25209910 2014 The L-selectin Phe206Leu gene polymorphism is not associated with visceral leishmaniasis.
25095634 2014 [The analysis of the influence of short term physical effort on selected endothelial function parameters and blood vessels stiffness features among young and healthy men].
24829027 2014 L-selectin ligands expression in human fallopian tube epithelia of tubal pregnancies.
24631064 2014 Plasma and serum L-selectin and clinical and subclinical cardiovascular disease: the Multi-Ethnic Study of Atherosclerosis (MESA).
24606340 2014 Neutrophils recruit and activate human endothelial colony-forming cells at the site of vessel injury via P-selectin glycoprotein ligand-1 and L-selectin.
24595810 2014 Mineralocorticoid receptor signaling reduces numbers of circulating human naïve T cells and increases their CD62L, CCR7, and CXCR4 expression.
24516598 2014 Serum adhesion molecule levels as prognostic markers in patients with early systemic sclerosis: a multicentre, prospective, observational study.
24399259 2014 Two new susceptibility loci 1q24.2 and 11p11.2 confer risk to severe acne.
24127491 2013 The PSGL-1-L-selectin signaling complex regulates neutrophil adhesion under flow.
23927766 2014 Quantifying the biomechanics of conception: L-selectin-mediated blastocyst implantation mechanics with engineered "trophospheres".
23925765 2013 L-selectin is a possible biomarker for individual PML risk in natalizumab-treated MS patients.
23796515 2013 FERM domain of moesin desorbs the basic-rich cytoplasmic domain of l-selectin from the anionic membrane surface.
23658780 2013 Calmodulin adopts an extended conformation when interacting with L-selectin in membranes.
23573259 2013 Toll-Like Receptor induced CD11b and L-selectin response in patients with coronary artery disease.
23571167 2013 Age is an important determinant in humoral and T cell responses to immunization with hepatitis B surface antigen.
23487023 2013 NK cell CD16 surface expression and function is regulated by a disintegrin and metalloprotease-17 (ADAM17).
23442851 2013 Effect of extracellular pH on selectin adhesion: theory and experiment.
23319734 2013 Mitochondrial superoxide generation enhances P2X7R-mediated loss of cell surface CD62L on naive human CD4+ T lymphocytes.
23028631 2012 L-selectin and skin damage in systemic sclerosis.
22977256 2012 Glycodelin-A stimulates interleukin-6 secretion by human monocytes and macrophages through L-selectin and the extracellular signal-regulated kinase pathway.
22941246 2012 Lymphoid priming in human bone marrow begins before expression of CD10 with upregulation of L-selectin.
22921892 2012 Association of P213S polymorphism of the L-selectin gene with type 2 diabetes and insulin resistance in Chinese population.
22836626 2013 Plasma selectins in patients with obstructive sleep apnea.
22627390 2012 Selectin-mediated adhesion in shear flow using micropatterned substrates: multiple-bond interactions govern the critical length for cell binding.
22159147 2012 Mucin 16 is a functional selectin ligand on pancreatic cancer cells.
22119815 2011 Investigation of P213S SELL gene polymorphism in type 2 diabetes mellitus and related end stage renal disease. A case-control study.
22068558 2011 Relationship between plasma aldosterone concentration and soluble cellular adhesion molecules in patients referred to coronary angiography.
21869829 2012 L-selectin and SDF-1 enhance the migration of mouse and human cardiac mesoangioblasts.
21664913 2011 Interaction of calmodulin with L-selectin at the membrane interface: implication on the regulation of L-selectin shedding.
21584225 2011 Lower frequency of CD62L(high) and higher frequency of TNFR2(+) Tregs are associated with inflammatory conditions in type 1 diabetic patients.
21546114 2012 L-selectin--a dynamic regulator of leukocyte migration.
21521525 2011 Evaluation of variants in the selectin genes in age-related macular degeneration.
21484243 2011 Reduced plasma levels of P-selectin and L-selectin in a pilot study from Alzheimer disease: relationship with neuro-degeneration.
21465128 2011 The association of L-selectin polymorphisms with L-selectin serum levels and risk of ischemic stroke.
21316337 2011 L-selectin transmembrane and cytoplasmic domains are monomeric in membranes.
21237580 2011 Regulation of L-selectin expression by trauma-relevant cytokines.
21197561 2011 sLeX/L-selectin mediates adhesion in vitro implantation model.
20925194 2010 NFAT regulates CSF-1 gene transcription triggered by L-selectin crosslinking.
20708610 2010 CD62L on neutrophil granulocytes, a useful, complementary marker for the prediction of ventriculitis in blood-containing CSF.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20580062 2011 Selectins in human amniotic fluid and cord blood plasma. A preliminary report.
20507883 2010 Human L-selectin preferentially binds synthetic glycosulfopeptides modeled after endoglycan and containing tyrosine sulfate residues and sialyl Lewis x in core 2 O-glycans.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20469932 2010 N-glycan analysis of recombinant L-Selectin reveals sulfated GalNAc and GalNAc-GalNAc motifs.
20306662 2007 Alterations in neutrophil surface expression of L-selectin (CD62L) and soluble L-selectin (sL-selectin) in hemodialysis patients: relation to HCV.
20220571 2010 Genetic polymorphisms of adhesion molecules and kidney transplant survival.
20212041 2010 The transmembrane domains of L-selectin and CD44 regulate receptor cell surface positioning and leukocyte adhesion under flow.
20193033 2010 Highly sensitivity adhesion molecules detection in hereditary haemochromatosis patients reveals altered expression.
20065025 2010 Mucin AgC10 from Trypanosoma cruzi Interferes with L-selectin-mediated monocyte adhesion.
19954409 2010 The adhesion molecules of L-selectin and ICAM-1 in thrombocytosis and thrombocytopenia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19837408 2010 Angiotensin II induces CD62L shedding in human neutrophils.
19670701 2009 Expression of selected adhesion molecules in dermatitis herpetiformis and bullous pemphigoid.
19654311 2009 Down-regulation of CXCR4 and CD62L in chronic lymphocytic leukemia cells is triggered by B-cell receptor ligation and associated with progressive disease.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19462221 2009 Expression of CD62L on donor CD4(+) T cells in allografts: correlation with graft-versus-host disease after unmanipulated allogeneic blood and marrow transplantation.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
19419934 2009 Increased percentage of L-selectin+ and ICAM-1+ peripheral blood CD4+/CD8+ T cells in active Graves' ophthalmopathy.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19240957 2009 Candidate gene analysis of selectin cluster in patients with multiple sclerosis.
19212205 2009 Polymorphism in ICAM-1, PECAM-1, E-selectin, and L-selectin genes in Tunisian patients with inflammatory bowel disease.
19129194 2009 In Vitro and in Vivo Characterization of Molecular Interactions between Calmodulin, Ezrin/Radixin/Moesin, and L-selectin.
19118161 2009 Podocalyxin-like protein is an E-/L-selectin ligand on colon carcinoma cells: comparative biochemical properties of selectin ligands in host and tumor cells.
19088176 2009 Dermatan sulfate proteoglycan biglycan as a potential selectin L/CD44 ligand involved in selective recruitment of peripheral blood CD16(-) natural killer cells into human endometrium.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
19052753 2009 Decrease in adhesion molecules on polymorphonuclear leukocytes of patients with fibromyalgia.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18973547 2009 E-selectin and L-selectin polymorphisms in patients with periodontitis.
18829897 2008 Inhibition of Na+/H+ exchanger enhances low pH-induced L-selectin shedding and beta2-integrin surface expression in human neutrophils.
18713968 2008 FOXO1 regulates L-Selectin and a network of human T cell homing molecules downstream of phosphatidylinositol 3-kinase.
18713749 2008 P-selectin glycoprotein ligand-1 decameric repeats regulate selectin-dependent rolling under flow conditions.
18665829 2008 l-selectin gene polymorphisms and complications of sickle cell disease.
18619508 2008 L-selectin ligation-induced CSF-1 gene transcription is regulated by AP-1 in a c-Abl kinase-dependent manner.
18606703 2008 Endoglycan, a member of the CD34 family of sialomucins, is a ligand for the vascular selectins.
18582506 2008 The temporal redistribution pattern of NK cells under acute stress based on CD62L adhesion molecule expression.
18496641 2008 Neutrophil surface expression of CD11b and CD62L in diabetic microangiopathy.
18385135 2008 L-selectin-mediated lymphocyte-cancer cell interactions under low fluid shear conditions.
18375392 2008 Carcinoembryonic antigen and CD44 variant isoforms cooperate to mediate colon carcinoma cell adhesion to E- and L-selectin in shear flow.
18250165 2008 Replacing a lectin domain residue in L-selectin enhances binding to P-selectin glycoprotein ligand-1 but not to 6-sulfo-sialyl Lewis x.
18191640 2008 Circulating P-, L- and E-selectins in pseudoxanthoma elasticum patients.
18182036 2008 Selectin haplotypes and the risk of venous thrombosis: influence of linkage disequilibrium with the factor V Leiden mutation.
18089680 2008 Striking alteration of some populations of T/B cells in systemic lupus erythematosus: relationship to expression of CD62L or some chemokine receptors.
18032547 2008 Tubulointerstitial heparan sulfate proteoglycan changes in human renal diseases correlate with leukocyte influx and proteinuria.
18028430 2008 Evaluation of the prognostic relevance of L-selectin and ICAM1 expression in myelodysplastic syndromes.
17954174 2007 Adhesion molecule polymorphisms in acute renal allograft rejection.
17890399 2008 Monitoring receptor-ligand interactions between surfaces by thermal fluctuations.
17765649 Mobilization of human CD34+ CD133+ and CD34+ CD133(-) stem cells in vivo by consumption of an extract from Aphanizomenon flos-aquae--related to modulation of CXCR4 expression by an L-selectin ligand?
17706337 2008 Adhesion molecules changes at 20 gestation weeks in pregnancies complicated by preeclampsia.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17698668 2007 Virus-associated host CD62L increases attachment of human immunodeficiency virus type 1 to endothelial cells and enhances trans infection of CD4+ T lymphocytes.
17548643 2007 Expression and regulation of the metalloproteinase ADAM-8 during human neutrophil pathophysiological activation and its catalytic activity on L-selectin shedding.
17525255 2007 Subendothelial heparan sulfate proteoglycans become major L-selectin and monocyte chemoattractant protein-1 ligands upon renal ischemia/reperfusion.
17515951 2007 Expression of selected integrins and selectins in bullous pemphigoid.
17465998 2007 L-selectin gene polymorphisms in Graves' disease.
17407075 2007 [Association of L-selectin gene polymorphism with susceptibility to coronary heart disease].
17056762 2007 Apoptosis induced in HIV-1-exposed, resting CD4+ T cells subsequent to signaling through homing receptors is Fas/Fas ligand-mediated.
17055225 2006 Decreased expression levels of CD22 and L-selectin on peripheral blood B lymphocytes from patients with bullous pemphigoid.
17028146 2007 Transport governs flow-enhanced cell tethering through L-selectin at threshold shear.
16982492 2006 Selectin polymorphisms and perinatal morbidity in low-birthweight infants.
16974056 2006 Impact of selectin gene polymorphisms on rapid progression to end-stage renal disease in patients with IgA nephropathy.
16916660 2006 Polymorphism in L-selectin, E-selectin and ICAM-1 genes in Asian Indian pediatric patients with celiac disease.
16740600 2006 CD21 and CD62L shedding are both inducible via P2X7Rs.
16738933 2006 Functional impact of IgA nephropathy-associated selectin gene haplotype on leukocyte-endothelial interaction.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16690519 2006 Dendritic cells are significantly reduced in non-Hodgkin's lymphoma and express less CCR7 and CD62L.
16585636 2006 Association between the Phe206Leu polymorphism of L-selectin and brucellosis.
16565092 2006 HCELL is the major E- and L-selectin ligand expressed on LS174T colon carcinoma cells.
16357481 2006 Association of the Phe206Leu allele of the L-selectin gene with coronary artery disease.
16352650 2006 Variant isoforms of CD44 are P- and L-selectin ligands on colon carcinoma cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16270299 Soluble adhesion molecules in young children with signs of beta-cell autoimmunity--prospective follow-up from birth.
15831305 2005 Differential expression of L-selectin ligand in the endometrium during the menstrual cycle.
15776384 2005 Levels of L-selectin (CD62L) on human leukocytes in disseminated cryptococcosis with and without associated HIV-1 infection.
15506984 2004 The telling tail of L-selectin.
15470072 2004 Role of L-selectin in the vascular homing of peripheral blood-derived endothelial progenitor cells.
15192100 2004 The interaction of protein kinase C isozymes alpha, iota, and theta with the cytoplasmic domain of L-selectin is modulated by phosphorylation of the receptor.
15178693 2004 Mutagenesis of the ezrin-radixin-moesin binding domain of L-selectin tail affects shedding, microvillar positioning, and leukocyte tethering.
15093751 2004 Increased expression of the selectin ligand sialyl-Lewis(x) by biochemical engineering of sialic acids.
14737745 Soluble adhesion molecules in Finnish schoolchildren with signs of preclinical type 1 diabetes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615387 2004 Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.
14597772 2003 Avidity enhancement of L-selectin bonds by flow: shear-promoted rotation of leukocytes turn labile bonds into functional tethers.
14592723 2003 L-selectin and E-selectin expressed on monocytes mediating Ehrlichia chaffeensis attachment onto host cells.
14585903 2003 Prospective, serial investigations of in-vitro lymphocyte cytokine production, CD62L expression and proliferative response to microbial antigens in women with recurrent miscarriage.
14576059 2004 CXCR4 engagement is required for HIV-1-induced L-selectin shedding.
14533031 2003 The relationship between soluble L-selectin and the development of diabetic retinopathy.
12918706 2003 L-selectin expression on leukocytes of patients with Behçet's disease.
12874338 2003 Diminished adhesion of Anaplasma phagocytophilum-infected neutrophils to endothelial cells is associated with reduced expression of leukocyte surface selectin.
12871600 2003 Genetic risk factors for cerebrovascular disease in children with sickle cell disease: design of a case-control association study and genomewide screen.
12844406 2003 [Study on expression of cell surface L-selectin and soluble L-selectin in patients with acute leukemia].
12738381 2003 Interactions of the gastrotropic bacterium Helicobacter pylori with the leukocyte-endothelium adhesion molecules, the selectins--a preliminary report.
12736247 2003 Model glycosulfopeptides from P-selectin glycoprotein ligand-1 require tyrosine sulfation and a core 2-branched O-glycan to bind to L-selectin.
12609846 2003 L-selectin stimulation enhances functional expression of surface CXCR4 in lymphocytes: implications for cellular activation during adhesion and migration.
12595908 2003 Variation in immune response genes and chronic Q fever. Concepts: preliminary test with post-Q fever fatigue syndrome.
12588680 Expression of potential lymphocyte trafficking mediator molecules in the mammary gland.
12532021 2003 Trophoblast L-selectin-mediated adhesion at the maternal-fetal interface.
12496379 2003 Cutting edge: L-selectin (CD62L) expression distinguishes small resting memory CD4+ T cells that preferentially respond to recall antigen.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12431911 2003 Topographic requirements and dynamics of signaling via L-selectin on neutrophils.
12403782 2003 Molecular basis of leukocyte rolling on PSGL-1. Predominant role of core-2 O-glycans and of tyrosine sulfate residue 51.
12370391 2002 Leukocyte rolling velocities and migration are optimized by cooperative L-selectin and intercellular adhesion molecule-1 functions.
12202158 2002 Ultrastructural examination of cytoskeletal linkage of L-selectin and comparison of L-selectin cytoskeletal association to that of other human and bovine lymphocyte surface antigens.
12200386 2002 Hydrocortisone reduced in vivo, inflammation-induced slow rolling of leukocytes and their extravasation into human conjunctiva.
12200076 Leukocyte-endothelial cell adhesion molecule 1 (LECAM-1) polymorphism is associated with diabetic nephropathy in type 2 diabetes mellitus.
12186696 2002 L and E selectins in acute myeloid leukemia: expression, clinical relevance and relation to patient outcome.
12165498 2002 L-selectin serves as an E-selectin ligand on cultured human T lymphoblasts.
12147693 2002 Structure-function relationship and role of tumor necrosis factor-alpha-converting enzyme in the down-regulation of L-selectin by non-steroidal anti-inflammatory drugs.
12144128 CD62L (L-selectin).
12036888 2002 Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes.
11907045 2002 L-selectin dimerization enhances tether formation to properly spaced ligand.
11828340 2002 Association between single-nucleotide polymorphisms in selectin genes and immunoglobulin A nephropathy.
11466384 2001 The cytoplasmic domain of L-selectin participates in regulating L-selectin endoproteolysis.
11064106 2000 L-selectin gene T668C mutation in type 1 diabetes patients and their first degree relatives.
10882119 2000 A novel ligand of the formyl peptide receptor: annexin I regulates neutrophil extravasation by interacting with the FPR.
10747985 2000 An activated L-selectin mutant with conserved equilibrium binding properties but enhanced ligand recognition under shear flow.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7680663 1993 Higher-affinity oligosaccharide ligands for E-selectin.
7488174 1995 A template for generation and comparison of three-dimensional selectin models.
2664786 1989 Human homologue of mouse lymph node homing receptor: evolutionary conservation at tandem cell interaction domains.
2663882 1989 Characterization of a human homologue of the murine peripheral lymph node homing receptor.
2509939 1989 Leu-8/TQ1 is the human equivalent of the Mel-14 lymph node homing receptor.
2473156 1989 Isolation and chromosomal localization of cDNAs encoding a novel human lymphocyte cell surface molecule, LAM-1. Homology with the mouse lymphocyte homing receptor and other human adhesion proteins.
1717161 1991 Selectins: a family of adhesion receptors.
1692315 1990 Structure of the gene encoding the human leukocyte adhesion molecule-1 (TQ1, Leu-8) of lymphocytes and neutrophils.
1376638 1992 An endothelial ligand for L-selectin is a novel mucin-like molecule.
1375831 1992 Cell-cell contact mechanisms.