Property Summary

NCBI Gene PubMed Count 20
PubMed Score 68.89
PubTator Score 19.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.035 5.4e-04
astrocytic glioma -1.300 2.5e-02
oligodendroglioma -1.100 3.4e-02
cutaneous lupus erythematosus -1.100 6.2e-03
group 3 medulloblastoma -1.400 2.9e-05
medulloblastoma, large-cell -1.800 8.3e-05
tuberculosis 1.100 2.6e-08
adult high grade glioma -1.100 1.9e-03
ovarian cancer 1.900 1.4e-04

Gene RIF (11)

PMID Text
26474786 SelW may have a regulatory function in redox cell signaling by interacting with 14-3-3 protein.
25721765 Suppression of EGFR ubiquitination by SEPW1 may be related to the putative increase in cancer risk associated with high selenium intakes.
23830627 In response to selenium compounds, SepW1 synthesis increased at the protein and the mRNA levels.
22730327 SEPW1 silencing increases MKK4, which activates p38gamma, p38delta, and JNK2 to phosphorylate p53 on Ser-33 and cause a transient G(1) arrest.
21875573 The present work shows that SEPW1 facilitates the G1 to S-phase transition by down-regulating expression of the cyclin-dependent kinase inhibitor p21
21866568 p53 was increased in SEPW1 silenced cells and was inversely correlated with SEPW1 mRNA in cell lines with altered SEPW1 expression.
19690192 The small interfering RNA knockdown of BNIP3, IER3, and SEPW1 genes affected critical multiple myeloma endothelial cell functions correlated with the overangiogenic phenotype
19387567 SEPW1 mRNA levels were maximal during G1-phase, dropped after the G1/S transition and increased again after G2/M-phase.
15823556 SeW is the novel molecular target of MeHg in human neuronal cells and down-regulation of this selenoenzyme by MeHg is dependent not on generation of ROS but on depletion of GSH.
15670848 SelW expression in the colon is highly sensitive to Se-depletion
12818432 The gene lacks canonical TATA and CAAT boxes, but has numerous Sp1 consensus binding sites upstream of multiple transcription start sites. SEPW1 is expressed in all of the 22 tissues assayed, and shows highest expression in skeletal muscle and heart.

AA Sequence

MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTE      1 - 70
SKFLKLVAAIKAALAQG                                                          71 - 87
//

Text Mined References (22)

PMID Year Title
26474786 2016 Identification of a redox-modulatory interaction between selenoprotein W and 14-3-3 protein.
25721765 2015 Selenoprotein W controls epidermal growth factor receptor surface expression, activation and degradation via receptor ubiquitination.
23830627 2013 Selenoprotein W as biomarker for the efficacy of selenium compounds to act as source for selenoprotein biosynthesis.
22730327 2012 Delayed cell cycle progression in selenoprotein W-depleted cells is regulated by a mitogen-activated protein kinase kinase 4-p38/c-Jun NH2-terminal kinase-p53 pathway.
21875573 2011 Delayed cell cycle progression from SEPW1 depletion is p53- and p21-dependent in MCF-7 breast cancer cells.
21866568 2012 Selenoprotein W depletion induces a p53- and p21-dependent delay in cell cycle progression in RWPE-1 prostate epithelial cells.
19690192 2009 Gene expression profiling of bone marrow endothelial cells in patients with multiple myeloma.
19387567 2009 Selenoprotein W modulates control of cell cycle entry.
17503775 2007 SelT, SelW, SelH, and Rdx12: genomics and molecular insights into the functions of selenoproteins of a novel thioredoxin-like family.
15823556 2005 Selenoprotein W as molecular target of methylmercury in human neuronal cells is down-regulated by GSH depletion.
15670848 2005 Effects of Se-depletion on glutathione peroxidase and selenoprotein W gene expression in the colon.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12818432 2003 Gene structure and tissue expression of human selenoprotein W, SEPW1, and identification of a retroprocessed pseudogene, SEPW1P.
12775843 2003 Characterization of mammalian selenoproteomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11215511 2000 Selenoprotein W: a review.
10718624 2000 Selenoprotein W accumulates primarily in primate skeletal muscle, heart, brain and tongue.
10708517 2000 A transcript map of the chromosome 19q-arm glioma tumor suppressor region.
9256076 1997 Conserved features of selenocysteine insertion sequence (SECIS) elements in selenoprotein W cDNAs from five species.
7896009 1995 Tissue distribution and influence of selenium status on levels of selenoprotein W.