Property Summary

NCBI Gene PubMed Count 13
PubMed Score 25.56
PubTator Score 10.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.389 4.9e-08
adult high grade glioma -1.100 7.5e-04
atypical teratoid / rhabdoid tumor -2.000 5.5e-05
Breast cancer 3.600 2.6e-02
glioblastoma -1.500 9.2e-04
group 3 medulloblastoma -1.100 4.0e-03
medulloblastoma, large-cell -1.300 3.6e-05
Multiple myeloma 2.321 6.3e-04
non primary Sjogren syndrome sicca 1.300 1.9e-02
osteosarcoma 1.686 3.7e-04
ovarian cancer -1.500 7.8e-05

Gene RIF (2)

AA Sequence

MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIR      1 - 70
IEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIE     71 - 140
NQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS                   141 - 195
//

Text Mined References (14)

PMID Year Title