Property Summary

NCBI Gene PubMed Count 61
PubMed Score 800.65
PubTator Score 75.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 3.6e-02
ovarian cancer 2.300 5.6e-05

Gene RIF (41)

PMID Text
26504085 interaction between SelK and p97(VCP) is SelS-dependent, and the resulting ERAD complex (SelS-p97(VCP)-SelK) plays an important role in ERAD and ER stress
26016409 Potential roles of the SEPS1 gene in the pathogenesis and etiology of Hashimoto's thyroiditis.
25433273 The SEPS1 -105G>A is associated with an increased risk of Kashin-Beck disease and influences the expression of PI3K/Akt signaling pathway in Kashin-Beck disease patients
25390504 SNP rs4965814 of SELS may affect the susceptibility to ischemic stroke.
25008318 Although VIMP can interact with CLIMP-63 and Syn5L, it does not interact with MT-binding ER proteins (such as Reep1) that shape the tubular smooth ER
24700463 Pro(178) and Pro(183) of SelS play important roles in the translocation of p97(VCP) to the ER membrane and protect cells from ER stress
24573439 that SEPS1 may protect mice against LPS-induced sepsis and organ damage. Therefore, SEPS1 may be a new target to resolve LPS-induced sepsis.
24471570 Existence of a link between SEPS1 promoter genetic variation and Hashimoto thyroiditis risk.
24275540 Selenoprotein S is a marker but not a regulator of endoplasmic reticulum stress in intestinal epithelial cells in inflammatory bowel diseases.
23914919 Data suggest that selenocysteine allows selenoprotein S (SelS, VIMP) to sustain activity under oxidative stress.
23829426 Our results indicated that the rs12910524 in the Tanis gene was associated with triglyceride concentrations in subjects without diabetes in China.
23776519 Findings suggest that the SEPS1 G-105A polymorphism contributes to the risk of developing SPTB in a Chinese population.
23161441 These results suggest a potential role for the SELS region in the development subclinical cardiovascular disease in this sample enriched for type 2 diabetes mellitus.
22700979 the redox properties observed for recombinant VIMP are compatible with a function as a reductase
21456042 Upregulation of SelS expression in reactive astrocytes reveals a new protective role for SelS against inflammation and endoplasmic reticulum stress that can be relevant to astrocyte function.
21052528 Observational study of gene-disease association. (HuGE Navigator)
20619427 a role for SELS in the development of metabolic disease, especially in the context of insulin resistance.
20619427 Observational study of gene-disease association. (HuGE Navigator)
20378690 Observational study of gene-disease association. (HuGE Navigator)
20114070 beta-ME, also an ER stress agent, could induce cell apoptosis, and SelS may play an important role in protecting cells from apoptosis induced by ER stress in HepG2 cells.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19398551 Selenoprotein S/SEPS1 modifies endoplasmic reticulum stress in Z variant alpha1-antitrypsin deficiency.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19144102 The -105G>A promoter polymorphism of SEPS1 was associated with the intestinal type of gastric cancer.
19144102 Observational study of gene-disease association. (HuGE Navigator)
18974842 Observational study of gene-disease association. (HuGE Navigator)
18728048 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18710632 SelS protein may be involved in insulin resistance in Chinese with type 2 diabetes mellitus (T2DM) by acting as the SAA receptor, thus playing an important role in the development of T2DM and atherosclerosis
18675776 SelS has a role in lipopolysaccharide-induced inflammatory response in hepatoma HepG2 cells
18625033 Six polymorphisms were studied in this gene, and none are associated with type 1 diabetes, rheumatoid arthritis or inflammatory bowel diseases.
18625033 Observational study of gene-disease association. (HuGE Navigator)
18068137 Observational study of gene-disease association. (HuGE Navigator)
17880573 Selenoprotein S -105(adenosine) allele is a non-significant risk factor in young stroke patients from Italy and Germany.
17661913 -105G>A polymorphism is not associated with IBD susceptibility and does not contribute to a certain disease phenotype or increased TNF-alpha levels in IBD patients.
17641917 significant association with increased CHD risk in females carrying the minor allele of rs8025174. Another variant, rs7178239, increased the risk for ischemic stroke significantly in females.
17374524 SEPS1 protein is secreted from hepatoma cells. Fractionation of human serum indicated that SEPS1 was associated with LDL and possibly with VLDL.
16574427 SEPS1 may regulate cytokine production in macrophage cells and there may be a regulatory loop between TNF-alpha, IL-1beta and SEPS1 that plays a key role in control of the inflammatory response
16227999 Regulatory variant in SELS influences inflammatory response to ER stress
15215856 Derlin-1 interacts with US11, a virally encoded ER protein that specifically targets MHC class I heavy chains for export from the ER, as well as with VIMP, a novel membrane protein that recruits the p97 ATPase and its cofactor
15161744 Positive relationship between Tanis mRNA and the acute-phase protein serum amyloid A suggests an interaction between innate immune system responses and Tanis expression in muscle and adipose tissue.
15063746 SELS is regulated by glucose deprivation and endoplasmic reticulum stress. It is a glucose-regulated protein.

AA Sequence

MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAV      1 - 70
EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDS     71 - 140
PGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG                         141 - 189
//

Text Mined References (68)

PMID Year Title
26504085 2015 Selenoprotein S-dependent Selenoprotein K Binding to p97(VCP) Protein Is Essential for Endoplasmic Reticulum-associated Degradation.
26016409 2015 Association studies of SEPS1 gene polymorphisms with Hashimoto's thyroiditis in Han Chinese.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25433273 2015 Role of selenoprotein S (SEPS1) -105G>A polymorphisms and PI3K/Akt signaling pathway in Kashin-Beck disease.
25390504 2015 Association of selenoprotein S gene polymorphism with ischemic stroke in a Chinese case-control study.
25008318 2014 Valosin-containing protein-interacting membrane protein (VIMP) links the endoplasmic reticulum with microtubules in concert with cytoskeleton-linking membrane protein (CLIMP)-63.
24700463 2014 Pro178 and Pro183 of selenoprotein S are essential residues for interaction with p97(VCP) during endoplasmic reticulum-associated degradation.
24573439 2014 Protective effects of the SEPS1 gene on lipopolysaccharide-induced sepsis.
24471570 2014 A polymorphism in the promoter region of the selenoprotein S gene (SEPS1) contributes to Hashimoto's thyroiditis susceptibility.
24424410 2014 USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation.
24275540 2014 Selenoprotein S is a marker but not a regulator of endoplasmic reticulum stress in intestinal epithelial cells.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23914919 2013 Contribution of selenocysteine to the peroxidase activity of selenoprotein S.
23829426 2013 Genetic variation in Tanis was associated with elevating plasma triglyceride level in Chinese nondiabetic subjects.
23776519 2013 The SEPS1 G-105A polymorphism is associated with risk of spontaneous preterm birth in a Chinese population.
23614019 2013 Alternative transcripts and 3'UTR elements govern the incorporation of selenocysteine into selenoprotein S.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161441 2013 Polymorphisms in the Selenoprotein S gene and subclinical cardiovascular disease in the Diabetes Heart Study.
22708491 2012 Post-transcriptional control of selenoprotein biosynthesis.
22700979 2012 The human selenoprotein VCP-interacting membrane protein (VIMP) is non-globular and harbors a reductase function in an intrinsically disordered region.
22479358 2012 Composition and evolution of the vertebrate and mammalian selenoproteomes.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
21896481 2011 The general definition of the p97/valosin-containing protein (VCP)-interacting motif (VIM) delineates a new family of p97 cofactors.
21456042 2011 Selenoprotein S expression in reactive astrocytes following brain injury.
21269460 2011 Initial characterization of the human central proteome.
21052528 2010 Polymorphisms in the selenoprotein S and 15-kDa selenoprotein genes are associated with altered susceptibility to colorectal cancer.
20619427 2011 Expression of the selenoprotein S (SELS) gene in subcutaneous adipose tissue and SELS genotype are associated with metabolic risk factors.
20378690 2010 Genetic variants in selenoprotein genes increase risk of colorectal cancer.
20114070 2010 Influence of SelS gene silence on beta-Mercaptoethanol-mediated endoplasmic reticulum stress and cell apoptosis in HepG2 cells.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19398551 2009 Selenoprotein S/SEPS1 modifies endoplasmic reticulum stress in Z variant alpha1-antitrypsin deficiency.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19144102 2009 Selenoprotein S (SEPS1) gene -105G>A promoter polymorphism influences the susceptibility to gastric cancer in the Japanese population.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18728048 2009 Evidence of epistasis between interleukin 1 and selenoprotein-S with susceptibility to rheumatoid arthritis.
18710632 2008 Association of SelS mRNA expression in omental adipose tissue with Homa-IR and serum amyloid A in patients with type 2 diabetes mellitus.
18675776 2008 Role of SelS in lipopolysaccharide-induced inflammatory response in hepatoma HepG2 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18625033 2008 Polymorphisms in the selenoprotein S gene: lack of association with autoimmune inflammatory diseases.
18068137 2008 Genetic association of preeclampsia to the inflammatory response gene SEPS1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17880573 2007 No association of the -105 promoter polymorphism of the selenoprotein S encoding gene SEPS1 with cerebrovascular disease.
17661913 2007 The role of the selenoprotein S (SELS) gene -105G>A promoter polymorphism in inflammatory bowel disease and regulation of SELS gene expression in intestinal inflammation.
17641917 2007 Variation in the selenoprotein S gene locus is associated with coronary heart disease and ischemic stroke in two independent Finnish cohorts.
17374524 2007 Secretion of the glucose-regulated selenoprotein SEPS1 from hepatoma cells.
17210132 2007 SEPS1 protects RAW264.7 cells from pharmacological ER stress agent-induced apoptosis.
17000876 2006 Regulation of retrotranslocation by p97-associated deubiquitinating enzyme ataxin-3.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16574427 2006 Activation of the selenoprotein SEPS1 gene expression by pro-inflammatory cytokines in HepG2 cells.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16227999 2005 Genetic variation in selenoprotein S influences inflammatory response.
16186510 2005 Recruitment of the p97 ATPase and ubiquitin ligases to the site of retrotranslocation at the endoplasmic reticulum membrane.
16186509 2005 Multiprotein complexes that link dislocation, ubiquitination, and extraction of misfolded proteins from the endoplasmic reticulum membrane.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15229221 2004 Efficiency of mammalian selenocysteine incorporation.
15215856 2004 A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol.
15161744 2004 Relationship between serum amyloid A level and Tanis/SelS mRNA expression in skeletal muscle and adipose tissue from healthy and type 2 diabetic subjects.
15063746 2004 Regulation of the selenoprotein SelS by glucose deprivation and endoplasmic reticulum stress - SelS is a novel glucose-regulated protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12775843 2003 Characterization of mammalian selenoproteomes.
12663463 2003 Elevation in Tanis expression alters glucose metabolism and insulin sensitivity in H4IIE cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12031974 2002 Tanis: a link between type 2 diabetes and inflammation?
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.