Property Summary

NCBI Gene PubMed Count 82
PubMed Score 315.17
PubTator Score 106.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Multiple myeloma 2.877 4.3e-04
osteosarcoma 1.332 1.7e-03
posterior fossa group B ependymoma -1.400 4.0e-03
group 3 medulloblastoma -2.200 2.1e-03
non diabetic and post-ischemic heart fai... 1.100 4.7e-03
atypical teratoid/rhabdoid tumor -2.000 3.6e-04
medulloblastoma, large-cell -1.700 7.7e-03
Duchenne muscular dystrophy 1.171 9.1e-08
Atopic dermatitis -1.200 2.4e-03
pancreatic ductal adenocarcinoma liver m... -1.575 1.1e-03
non-small cell lung cancer -1.682 1.1e-25
intraductal papillary-mucinous adenoma (... -1.600 4.0e-04
intraductal papillary-mucinous neoplasm ... -2.800 1.8e-03
colon cancer -2.000 1.6e-02
lung cancer -2.600 2.1e-06
active ulcerative colitis 2.769 2.1e-02
cystic fibrosis -1.900 8.1e-03
lung adenocarcinoma -1.300 9.0e-06
lung carcinoma -1.500 1.2e-10
Breast cancer -1.400 4.3e-06
gastric carcinoma -1.200 4.2e-02
invasive ductal carcinoma -1.300 8.8e-03
ovarian cancer -2.400 1.4e-04
pituitary cancer -1.700 3.1e-05
Down syndrome 1.400 5.1e-03
chronic rhinosinusitis -1.029 3.8e-02

 GO Function (1)

Gene RIF (65)

PMID Text
26675765 women who carry the SEPP1 rs3877899 A allele are better able to maintain selenium status during pregnancy, and their GPx3 activity increases more with supplementation, which suggests better protection from low selenium status.
26514640 Selenoprotein P concentrations are not elevated in women with gestational diabetes mellitus but are associated with BMI and HDL cholesterol.
26399395 Studied gene-specific regulation of hepatic selenoprotein expression by interleukin-6; by testing human hepatocytes in culture, found IL-6 reduced the concentrations of SePP mRNA and secreted SePP in a dose-dependent manner.
26348725 Impaired renal function is positively correlated with serum concentrations of SePP.
25395084 this study provide preliminary genetic evidence that the SEPP1 functional variants contribute to the AAA risk.
24914767 These results demonstrated that SelP interacts with tubulin, alpha 1a (TUBA1A).
24708917 Data suggest that plasma SEPP1 level can be up-regulated by dietary factors; here, significantly higher plasma SEPP1 is observed in women at risk of pre-eclampsia treated with dietary supplement of selenium-enriched yeast started in first trimester.
24638201 Elevated SeP concentrations are independently associated with a reduced risk of MetS in children
24563517 SEPP1 rs7579 was found to be associated with lower risk of advanced prostate cancer.
24437729 The histidine-rich domain of selenoprotein P is capable of binding Cu ions in both oxidation states of Cu(+) and Cu(2+) with high affinity and of modulating Cu(+) and Cu(2+)-mediated ABETA aggregation, reactive oxygen species production, neurotoxicity.
24361887 SePP is not only involved in Selenium transport to testes supporting GPX4 biosynthesis but it also becomes secreted into seminal plasma.
24278290 data suggest that SEPP1 alters breast cancer risk among women with higher levels of NA ancestry
24257750 metformin decreases binding of FoxO3a, a direct target of AMPK, to the SEPP1 promoter.
24161883 Genetic variants in selenoprotein P plasma 1 gene (SEPP1) are associated with fasting insulin and first phase insulin response in Hispanics
24157689 Sepp1 secreted from epithelial cells may support the intestinal immune system by providing immune cells (including plasma cells) with selenium
24055274 AMPK activators ameliorated carrageenan-induced insulin resistance via SeP inhibition.
24039907 The data provide evidence that single nucleotide polymorphisms in SEPP1 and GPX1 modulate risk of breast cancer.
23770201 These results demonstrate that SEPP1 represents a previously unrecognized regulator of Polychlorinated biphenyl-induced biological effects.
23760059 We speculate that there could be a feedback regulation between hepatic Sepp1 and pancreatic insulin and that increased circulating Sepp1 might be the result rather than the cause of abnormal glucose metabolism.[Review]
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of selenoprotein P (SEPP1) in peptide-treated PBMCs
23268326 This study demonistrated that Sepp1 in midbrain was expressed in neurons of the substantia nigra (SN), and expression was concentrated within the centers of Lewy bodies, the pathological hallmark of Parkinson disease
23129481 SEPP1 genetic variation was associated with prostate cancer incidence; replication of these results in an independent dataset is necessary.
23056383 Higher tumor grade and tumor stage at diagnosis correlated to lower SePP and Se concentrations.
22932905 hepatocellular SAM-dependent protein methylation is required for both SEPP1 and gluconeogenic enzyme expression and that inhibition of protein arginine methylation might provide a route to therapeutic interventions in type II diabetes.
22715394 Selenium, selenoenzymes, oxidative stress and risk of neoplastic progression from Barrett's esophagus: results from biomarkers and genetic variants.
22496878 Circulating selenoprotein P levels were positively correlated with fasting plasma glucose and negatively associated with both total and high-molecular adiponectin in type 2 diabetics.
21677040 Circulating SeP concentrations were elevated in patients with glucose metabolism dysregulation and were related to various cardiometabolic parameters including insulin resistance, inflammation, and atherosclerosis.
21456065 Selenoprotein P levels in prostate cells determine basal reactive-oxygen-species levels and H2O2-induced cytotoxicity. Deregulation of selenoprotein P during prostate carcinogenesis may increase free radicals, thus promoting tumor development.
21052528 Observational study of gene-disease association. (HuGE Navigator)
21035759 Using serial analysis of gene expression and DNA chip methods, the study found that hepatic SeP mRNA levels correlated with insulin resistance in humans.
20875901 These findings suggest an association between the individual selenoprotein concentration and the presence of diabetes.
20852007 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20565998 The present results show no significant difference in genotype and allele distribution of SNP r25191g/a between individuals with Kashin-Beck disease and controls.
20565998 Observational study of gene-disease association. (HuGE Navigator)
20542496 Inflammation of the intestinal mucosa causes a decline in locally produced selenoprotein P in the colon that eventually may contribute to the emergence of inflammatory bowel disease-related colorectal cancer.
20521393 Our findings demonstrate that Selenoprotein P protects neuronal cells from amyloid beta-induced toxicity, suggesting a neuroprotective role for SelP in preventing neurodegenerative disorders.
20378690 Observational study of gene-disease association. (HuGE Navigator)
20360971 tear SeP is a key molecule to protect the ocular surface cells against environmental oxidative stress
20237496 Observational study of gene-disease association. (HuGE Navigator)
20178852 Observational study of gene-disease association. (HuGE Navigator)
19779296 Early decrease in Sel-P plasma concentrations was specifically observed in septic shock and was similar in SIRS patients whereas GPx activity remained unchanged.
19747622 In a study of 817 randomly selected adult Danes, the median selenoprotein P level in serum was 2.72 (2.18-3.49) mg/L. Serum selenoprotein P increased with age and was higher in men than in women.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19513589 The glucocorticoid receptor inhibits selenoprotein P transactivation via response elements; the finding provides insight into a potential mechanism of selenium redistribution during development.
19453253 Data conclude that functional polymorphisms in the SEPP-1 gene influence the proportion of SePP isoforms in plasma.
19215687 selenoprotein P expression was low in gastric adenocarcinoma tissues compared with control tissues
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19074884 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18483336 Four variants in SEPP1 were significantly associated with advanced colorectal adenoma risk.
18483336 Observational study of gene-disease association. (HuGE Navigator)
17986007 selenoprotein P reduces lipid hydroperoxides and maintains the viability of myofibroblasts. a novel pathophysiologic function of myofibroblasts as a generator of lipid hydroperoxides, and a self-defense mechanism against self-generated oxidative stress.
17961124 local Sepp expression is required to maintain selenium content in selenium-privileged tissues such as brain and testis during dietary selenium restriction
17937618 Both non-glycosylated and partially glycosylated SeP is utilised as selenium donor by target cells.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17536041 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17536041 Results reveal two common functional nucleotide polymorphisms within the human selenoprotein P gene that may predict behavior of biomarkers of selenium status and response to supplementation and thus susceptibility to disease.
17511039 SePmRNA expression in the tissues of normal liver and hepatocellular carcinoma (HCC) is significantly different, suggesting that SeP might play a role in the occurrence and development of HCC.
17245539 SePP-like immunoreactivity localizes to neurons and ependymal cells and thus appears strategically situated for maintenance and control of selenium-dependent anti-oxidative defense systems.
12423375 selenoprotein P functions as a Se-supply protein, delivering Se to the cells
12173025 A DNA-repeat structure within the promoter contains a functionally relevant polymorphism and is genetically unstable under conditions of mismatch repair deficiency
11280803 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUYLCILQASKLE      1 - 70
DLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRC     71 - 140
GRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHH    141 - 210
HNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKR    211 - 280
CINQLLCKLPTDSELAPRSUCCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPA    281 - 350
AUQISQQLIPTEASASURUKNQAKKUEUPSN                                           351 - 381
//

Text Mined References (86)

PMID Year Title
26675765 2016 Genetic polymorphisms that affect selenium status and response to selenium supplementation in United Kingdom pregnant women.
26514640 2015 Selenoprotein P is not elevated in gestational diabetes mellitus.
26399395 2015 Gene-specific regulation of hepatic selenoprotein expression by interleukin-6.
26348725 2015 Chronic Kidney Disease Distinctly Affects Relationship Between Selenoprotein P Status and Serum Thyroid Hormone Parameters.
25395084 2014 SEPP1 gene variants and abdominal aortic aneurysm: gene association in relation to metabolic risk factors and peripheral arterial disease coexistence.
24914767 2014 Direct interaction between selenoprotein P and tubulin.
24708917 2014 Effect of selenium on markers of risk of pre-eclampsia in UK pregnant women: a randomised, controlled pilot trial.
24638201 2014 Levels of circulating selenoprotein P, fibroblast growth factor (FGF) 21 and FGF23 in relation to the metabolic syndrome in young children.
24563517 2014 Selenoprotein gene variants, toenail selenium levels, and risk for advanced prostate cancer.
24437729 2014 Inhibitory effect of selenoprotein P on Cu(+)/Cu(2+)-induced A?42 aggregation and toxicity.
24361887 2014 Selenoprotein P in seminal fluid is a novel biomarker of sperm quality.
24278290 2013 SEPP1 influences breast cancer risk among women with greater native american ancestry: the breast cancer health disparities study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24257750 2014 Metformin suppresses expression of the selenoprotein P gene via an AMP-activated kinase (AMPK)/FoxO3a pathway in H4IIEC3 hepatocytes.
24161883 2014 Genetic variants in selenoprotein P plasma 1 gene (SEPP1) are associated with fasting insulin and first phase insulin response in Hispanics.
24157689 2014 Intestinal selenoprotein P in epithelial cells and in plasma cells.
24055274 2014 AMPK activator-mediated inhibition of endoplasmic reticulum stress ameliorates carrageenan-induced insulin resistance through the suppression of selenoprotein P in HepG2 hepatocytes.
24039907 2013 Association between polymorphisms in glutathione peroxidase and selenoprotein P genes, glutathione peroxidase activity, HRT use and breast cancer risk.
23770201 2013 Selenoprotein P regulates 1-(4-Chlorophenyl)-benzo-2,5-quinone-induced oxidative stress and toxicity in human keratinocytes.
23760059 2013 The relationship between selenoprotein P and glucose metabolism in experimental studies.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23268326 2012 Changes in selenoprotein P in substantia nigra and putamen in Parkinson's disease.
23129481 2013 Selenoprotein P genetic variants and mrna expression, circulating selenium, and prostate cancer risk and survival.
23056383 2012 Selenoprotein P status correlates to cancer-specific mortality in renal cancer patients.
22932905 2012 S-adenosylmethionine-dependent protein methylation is required for expression of selenoprotein P and gluconeogenic enzymes in HepG2 human hepatocytes.
22715394 2012 Selenium, selenoenzymes, oxidative stress and risk of neoplastic progression from Barrett's esophagus: results from biomarkers and genetic variants.
22496878 2012 Inverse correlation between serum levels of selenoprotein P and adiponectin in patients with type 2 diabetes.
21677040 2011 Serum selenoprotein P levels in patients with type 2 diabetes and prediabetes: implications for insulin resistance, inflammation, and atherosclerosis.
21456065 2011 Selenoprotein-P is down-regulated in prostate cancer, which results in lack of protection against oxidative damage.
21052528 2010 Polymorphisms in the selenoprotein S and 15-kDa selenoprotein genes are associated with altered susceptibility to colorectal cancer.
21035759 2010 A liver-derived secretory protein, selenoprotein P, causes insulin resistance.
20875901 2010 Plasma selenoproteins concentrations in type 2 diabetes mellitus--a pilot study.
20852007 2010 Effects of selenium status and polymorphisms in selenoprotein genes on prostate cancer risk in a prospective study of European men.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20565998 2010 Selenoprotein P gene r25191g/a polymorphism and quantification of selenoprotein P mRNA level in patients with Kashin-Beck disease.
20542496 2010 Proinflammatory cytokines down-regulate intestinal selenoprotein P biosynthesis via NOS2 induction.
20521393 2010 Role of selenoprotein P in Alzheimer's disease.
20378690 2010 Genetic variants in selenoprotein genes increase risk of colorectal cancer.
20360971 2010 Selenoprotein P controls oxidative stress in cornea.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20178852 2010 Association study between polymorphisms in selenoprotein genes and susceptibility to Kashin-Beck disease.
19779296 2009 Selenoprotein P, rather than glutathione peroxidase, as a potential marker of septic shock and related syndromes.
19747622 2009 Serum selenium and selenoprotein P status in adult Danes - 8-year followup.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19513589 2009 Selenoprotein P regulation by the glucocorticoid receptor.
19453253 2009 Relative abundance of selenoprotein P isoforms in human plasma depends on genotype, se intake, and cancer status.
19215687 Tissue microarray assessment of selenoprotein P expression in gastric adenocarcinoma.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19074884 2008 Interaction between single nucleotide polymorphisms in selenoprotein P and mitochondrial superoxide dismutase determines prostate cancer risk.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18483336 2008 Variation in the selenoenzyme genes and risk of advanced distal colorectal adenoma.
17986007 2007 Involvement of selenoprotein P in the regulation of redox balance and myofibroblast viability in idiopathic pulmonary fibrosis.
17961124 2008 Hepatic selenoprotein P (SePP) expression restores selenium transport and prevents infertility and motor-incoordination in Sepp-knockout mice.
17937618 2007 Post-translational processing of selenoprotein P: implications of glycosylation for its utilisation by target cells.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17536041 2007 Genetic polymorphisms in the human selenoprotein P gene determine the response of selenoprotein markers to selenium supplementation in a gender-specific manner (the SELGEN study).
17511039 2007 Selenoprotein P mRNA expression in human hepatic tissues.
17245539 2007 Neuronal and ependymal expression of selenoprotein P in the human brain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12423375 2002 Characterization of selenoprotein P as a selenium supply protein.
12173025 2002 A complex DNA-repeat structure within the Selenoprotein P promoter contains a functionally relevant polymorphism and is genetically unstable under conditions of mismatch repair deficiency.
11442337 Association of selenoprotein P with testosterone production in cultured Leydig cells.
11280803 2001 Distribution and functional consequences of nucleotide polymorphisms in the 3'-untranslated region of the human Sep15 gene.
11278668 2001 Heparin-binding histidine and lysine residues of rat selenoprotein P.
10782998 2000 Binding of selenoprotein P to heparin: characterization with surface plasmon resonance.
10775431 2000 Selenoprotein P: properties, functions, and regulation.
9918658 1999 Separation of selenium-containing proteins in human and mouse plasma using tandem high-performance liquid chromatography columns coupled with inductively coupled plasma-mass spectrometry.
9915822 1999 Selenoprotein P in human plasma as an extracellular phospholipid hydroperoxide glutathione peroxidase. Isolation and enzymatic characterization of human selenoprotein p.
9735174 1998 A novel method for the purification of selenoprotein P from human plasma.
8884283 1996 Human selenoprotein P gene maps to 5q31.
8421687 1993 Conserved nucleotide sequences in the open reading frame and 3' untranslated region of selenoprotein P mRNA.
8142465 1994 Purification of selenoprotein P from human plasma.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7931697 1994 Selenoprotein P. A selenium-rich extracellular glycoprotein.
2037562 1991 The cDNA for rat selenoprotein P contains 10 TGA codons in the open reading frame.