Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 10.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Synonym

Accession Q8IZQ5 Q8N672 SelH
Symbols SELH
C11orf31
C17orf10

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (8)

PMID Text
25336634 Selenoprotein H suppresses cellular senescence through genome maintenance and redox regulation.
23220172 We conclude that the effects of selenoprotein H on mitochondrial biogenesis and mitochondrial function are probably mediated through protein kinase A-CREB-PGC-1alpha and Akt/protein kinase B-CREB-PGC-1alpha pathways.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20656065 Overexpression of SelH promotes mitochondrial biogenesis and improves mitochondrial functional performance.
19766117 t SelH protects neurons against UVB-induced damage by inhibiting apoptotic cell death pathways
17526492 selenoprotein H is a redox-responsive DNA-binding protein of the AT-hook family and functions in regulating expression levels of genes involved in de novo glutathione synthesis and phase II detoxification in response to redox status.
17389926 hSelH overexpression protects cells from UVB irradiation-induced murine hippocampal neuronal cell death by reducing the superoxide formation.
17337453 SelH is a novel nucleolar oxidoreductase that may have functions which are regulated by redox and dependent on the trace element selenium

AA Sequence

MAPRGRKRKAEAAVVAVAEKREKLANGGEGMEEATVVIEHCTSURVYGRNAAALSQALRLEAPELPVKVN      1 - 70
PTKPRRGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKYLS                       71 - 122
//

Text Mined References (16)

PMID Year Title
25336634 2014 Selenoprotein H suppresses cellular senescence through genome maintenance and redox regulation.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23220172 2013 Overexpression of human selenoprotein H in neuronal cells enhances mitochondrial biogenesis and function through activation of protein kinase A, protein kinase B, and cyclic adenosine monophosphate response element-binding protein pathway.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20656065 2011 Upregulation of human selenoprotein H in murine hippocampal neuronal cells promotes mitochondrial biogenesis and functional performance.
19766117 2009 Overexpression of human selenoprotein H in neuronal cells ameliorates ultraviolet irradiation-induced damage by modulating cell signaling pathways.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17526492 2007 Selenoprotein H is a redox-sensing high mobility group family DNA-binding protein that up-regulates genes involved in glutathione synthesis and phase II detoxification.
17389926 2007 Overexpression of selenoprotein H reduces Ht22 neuronal cell death after UVB irradiation by preventing superoxide formation.
17337453 2007 Selenoprotein H is a nucleolar thioredoxin-like protein with a unique expression pattern.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12775843 2003 Characterization of mammalian selenoproteomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.