Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 10.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (9)

AA Sequence

MAPRGRKRKAEAAVVAVAEKREKLANGGEGMEEATVVIEHCTSURVYGRNAAALSQALRLEAPELPVKVN      1 - 70
PTKPRRGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKYLS                       71 - 122
//

Text Mined References (18)

PMID Year Title