Property Summary

NCBI Gene PubMed Count 27
PubMed Score 39.50
PubTator Score 32.21

Knowledge Summary

Patent

No data available

Gene RIF (18)

PMID Text
25728752 Results suggest that SEP15 plays important roles in the regulation of the G1 phase during the cell cycle as well as in cell motility of Chang liver cells offering a novel functional link between the cell cycle and cell motility.
25529450 Sep15 in Chang liver cells regulates the pathway that antagonizes RhoA/ROCK/MLC-dependent non-apoptotic bleb formation.
25249019 Concerning rs561104, the serum selenium concentration was higher in CC homozygotes (5.65 +/- 1.11 mug/dL) compared with T carriers (4.88 +/- 1.25 mug/dL, P = .044).
21052528 Observational study of gene-disease association. (HuGE Navigator)
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20852007 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20424130 This study provides evidence that SEP15 genetic variation may influence prostate cancer mortality
20424130 Observational study of gene-disease association. (HuGE Navigator)
20378690 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18239845 It appears that those with the Sep15 1125 AA genotype may benefit most from a higher Se intake, whereas in those with the GG or GA genotype, a higher Se status may increase the risk for lung cancer.
18239845 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15107826 SEP15, encoding a 15-kDa selenium-containing protein was shown to be downregulated in approximately 60% of MM cell lines and tumor specimens. A SEP15 polymorphic variant, 1125A, resides in the SECIS recognition element
12600282 Studies in mouse show that Sep15 may have redox function.
11898406 Genetic and functional analysis of mammalian Sep15 selenoprotein.

AA Sequence

MAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGC      1 - 70
CQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEE     71 - 140
LSILKWNTDSVEEFLSEKLERI                                                    141 - 162
//

Text Mined References (28)

PMID Year Title
25728752 2015 Cell Proliferation and Motility Are Inhibited by G1 Phase Arrest in 15-kDa Selenoprotein-Deficient Chang Liver Cells.
25529450 2015 Deficiency of the 15-kDa selenoprotein led to cytoskeleton remodeling and non-apoptotic membrane blebbing through a RhoA/ROCK pathway.
25249019 2014 SLC30A3 and SEP15 gene polymorphisms influence the serum concentrations of zinc and selenium in mature adults.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21052528 2010 Polymorphisms in the selenoprotein S and 15-kDa selenoprotein genes are associated with altered susceptibility to colorectal cancer.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20852007 2010 Effects of selenium status and polymorphisms in selenoprotein genes on prostate cancer risk in a prospective study of European men.
20424130 2010 A large prospective study of SEP15 genetic variation, interaction with plasma selenium levels, and prostate cancer risk and survival.
20378690 2010 Genetic variants in selenoprotein genes increase risk of colorectal cancer.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18239845 2008 Lung cancer risk associated with selenium status is modified in smoking individuals by Sep15 polymorphism.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15198809 2004 SMART amplification combined with cDNA size fractionation in order to obtain large full-length clones.
15107826 2004 Growth inhibition and induction of apoptosis in mesothelioma cells by selenium and dependence on selenoprotein SEP15 genotype.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12600282 2003 [Redox reactions of Sep15 and its relationship with tumor development].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11898406 2002 Genetic and functional analysis of mammalian Sep15 selenoprotein.
11278576 2001 Association between the 15-kDa selenoprotein and UDP-glucose:glycoprotein glucosyltransferase in the endoplasmic reticulum of mammalian cells.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10945981 2000 Structure-expression relationships of the 15-kDa selenoprotein gene. Possible role of the protein in cancer etiology.
9535873 1998 A new human selenium-containing protein. Purification, characterization, and cDNA sequence.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.