Property Summary

NCBI Gene PubMed Count 50
PubMed Score 257.83
PubTator Score 2990.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma -4.300 3.7e-08
astrocytic glioma -2.000 1.0e-02
psoriasis -1.500 1.7e-08
cutaneous lupus erythematosus -1.100 1.9e-02
osteosarcoma -3.992 1.9e-05
posterior fossa group A ependymoma 1.700 1.7e-09
group 4 medulloblastoma -1.900 9.1e-06
atypical teratoid / rhabdoid tumor -2.600 2.8e-08
medulloblastoma, large-cell -1.800 1.6e-03
adrenocortical carcinoma -2.283 2.7e-12
tuberculosis 1.200 2.8e-02
pancreatic ductal adenocarcinoma liver m... -1.126 2.1e-02
non-small cell lung cancer -3.049 5.4e-19
intraductal papillary-mucinous adenoma (... 2.200 1.4e-04
intraductal papillary-mucinous neoplasm ... 1.100 6.4e-03
lung cancer -4.000 3.2e-07
colon cancer -2.100 1.5e-02
active Crohn's disease -1.674 7.2e-03
ulcerative colitis -2.700 9.6e-09
cystic fibrosis -1.100 4.0e-04
lung adenocarcinoma -1.600 9.7e-09
adult high grade glioma -1.300 3.5e-03
pilocytic astrocytoma -1.700 1.1e-06
invasive ductal carcinoma -1.484 2.8e-03
nasopharyngeal carcinoma -1.800 3.8e-06
lung carcinoma -1.800 2.3e-25
mucosa-associated lymphoid tissue lympho... 2.634 6.4e-03
ovarian cancer -3.000 1.6e-07
pituitary cancer -1.400 4.6e-04

 GO Function (1)

 GO Process (1)

Gene RIF (31)

PMID Text
26593911 cysteine 57 is a critical determinant of SBP1 function and may play a significant role in mitochondrial function.
26241353 elevated transcript expression is widespread throughout the prefrontal cortex in schizophrenia
25993660 Data indicate that loss of SBP1 may play an independent contributing role in prostate cancer progression and its levels might be useful in distinguishing indolent from aggressive disease.
25974208 These results have revealed a novel mechanism that SELENBP1-mediated cancer inhibition is through altering lipid/glucose metabolic signaling pathways.
25227434 Decreased selenium-binding protein 1 mRNA expression is associated with renal cell carcinoma.
24874852 hSP56 plays an important role in regulating HIF-1alpha, which may be one of mechanisms of hSP56 expression in suppressing the malignant characteristics of prostate cancer cells.
24737289 the downregulated SELENBP1 expression was reactivated by inducing differentiation. Therefore, SELENBP1 is a potential pharmacological target for individualized CRC treatment.
23977169 Decreased SELENBP1 expression is an early event in lung squamous cell cancer tumorigenesis.
23704933 The expression level of SELENBP1 could be an important marker for predicting survival and effectiveness of selenium supplementation in breast cancer.
23483240 These results suggest that SBP1 plays a significant role in gastric cancer cell proliferation and modulates its response to anticancer drugs
22072582 Glutathione peroxidase (GPx)-1 enzyme activity is inversely correlated with selenium binding protein (SBP)-1 levels in prostate tissue, based on the Gleason score.
21497372 The 3-year survival rate of gastric cancer patients with high expression of selenium-binding protein 1 was significantly higher than that of patients with low expression
21338716 A reduced SELENBP1 expression by immunohistochemistry in liver tissues of patients with hepatocarcinoma (HCC), is reported.
21143902 Decreased expression of selenium-binding protein 1 in uterine leiomyoma may indicate a role of the protein in tumorigenesis.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20615253 evidence for recurrence of decreased copy-number of the SELENBP1 locus in three unrelated schizophrenia patients' cohorts but not in controls, raising the possibility of functional involvement of these mutations in the etiology of the disease
20615253 Observational study of gene-disease association. (HuGE Navigator)
20530237 SP1 is present in reduced levels in several cancer types as compared with normal tissues, and lower levels are associated with poor clinical prognosis.
20480265 The suppression of Selenium-binding protein 1 may be a late event in gastric carcinogenesis.
20354826 down-regulation of SBP1 may play a key role in the tumorigenic process of human gastric carcinoma
20332323 SELENBP1 expression may be an important predictor of response to chemoprevention or chemosensitization with certain forms of selenium in esophageal tissues.
19924303 SBP1 has tumor suppressor functions that are inhibited in colorectal cancer through epigenetic silencing
19896693 loss of selenium-binding protein 1 associated with increasing epithelial proliferation indicates selenium-binding protein 1 is involved in tumorigenesis of ovarian and micropapillary serous borderline tumor and low-grade serous carcinoma.
19596560 The genetic variation in SELENBP1 may influence risk for the disorder, while this significance did not remain when other inheritance models were considered.
19596560 Observational study of gene-disease association. (HuGE Navigator)
19118533 VDU1 was identified as a protein partner of hSP56.
18435490 Associated with differentiation of the normal colonic epithelia and may be a positive prognostic factor for survival in stage III colorectal carcinoma
18163446 Elevated SELENBP1 is a possibly consistent feature in the schizophrenic brain and this could underlie some commonalities of psychosis across the boundaries of diagnoses.
16645984 Suppression of SELENBP1 is a frequent and late event in colorectal carcinogenesis, and may contribute to the rapid progression of colorectal carcinoma.
16380993 changes of SELENBP1 expression in malignant ovarian cancer are an indicator of aberration of selenium/androgen pathways and may reveal prognostic information of ovarian cancer
15108003 SBP may be involved in the initial sequential events in rapid cell outgrowth, such as determining direction of cell outgrowth and recruitment of actin monomer.

AA Sequence

MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVIHRLPMPNLKD      1 - 70
ELHHSGWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHKVIEPKDIHAKCELAFLHTSH     71 - 140
CLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVL    141 - 210
RDGFNPADVEAGLYGSHLYVWDWQRHEIVQTLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKN    211 - 280
EGGTWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLF    281 - 350
LGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIRE    351 - 420
GSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI                      421 - 472
//

Text Mined References (58)

PMID Year Title
26593911 2015 A Critical Role for Cysteine 57 in the Biological Functions of Selenium Binding Protein-1.
26241353 2015 SELENBP1 expression in the prefrontal cortex of subjects with schizophrenia.
25993660 2015 Evidence that selenium binding protein 1 is a tumor suppressor in prostate cancer.
25974208 2015 Quantitative proteomic analysis reveals that anti-cancer effects of selenium-binding protein 1 in vivo are associated with metabolic pathways.
25227434 2014 Decreased selenium-binding protein 1 mRNA expression is associated with poor prognosis in renal cell carcinoma.
24874852 2014 Human selenium binding protein-1 (hSP56) is a negative regulator of HIF-1? and suppresses the malignant characteristics of prostate cancer cells.
24737289 2014 Selenium-binding protein 1 is associated with the degree of colorectal cancer differentiation and is regulated by histone modification.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23977169 2013 The function and significance of SELENBP1 downregulation in human bronchial epithelial carcinogenic process.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23704933 2013 Reduced selenium-binding protein 1 in breast cancer correlates with poor survival and resistance to the anti-proliferative effects of selenium.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23483240 2013 Selenium-binding protein 1 may decrease gastric cellular proliferation and migration.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22072582 2012 Inverse association between glutathione peroxidase activity and both selenium-binding protein 1 levels and Gleason score in human prostate tissue.
21497372 2011 Suppression of selenium-binding protein 1 in gastric cancer is associated with poor survival.
21338716 2011 Structural and functional studies of the human selenium binding protein-1 and its involvement in hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21143902 2010 The expression of selenium-binding protein 1 is decreased in uterine leiomyoma.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20615253 2010 Copy number variation of the SELENBP1 gene in schizophrenia.
20530237 2010 Functional and physical interaction between the selenium-binding protein 1 (SBP1) and the glutathione peroxidase 1 selenoprotein.
20480265 2011 Altered expression of selenium-binding protein 1 in gastric carcinoma and precursor lesions.
20354826 2011 Reduced selenium-binding protein 1 is associated with poor survival rate in gastric carcinoma.
20332323 2010 Decreased selenium-binding protein 1 in esophageal adenocarcinoma results from posttranscriptional and epigenetic regulation and affects chemosensitivity.
19924303 2009 Transcriptional regulation and biological functions of selenium-binding protein 1 in colorectal cancer in vitro and in nude mouse xenografts.
19896693 2010 Progressive loss of selenium-binding protein 1 expression correlates with increasing epithelial proliferation and papillary complexity in ovarian serous borderline tumor and low-grade serous carcinoma.
19596560 2009 Family-based association study of SELENBP1 in schizophrenia.
19118533 2009 Human selenium binding protein-1 (hSP56) interacts with VDU1 in a selenium-dependent manner.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18435490 2008 Expression of selenium-binding protein 1 characterizes intestinal cell maturation and predicts survival for patients with colorectal cancer.
18163446 2008 The utility of SELENBP1 gene expression as a biomarker for major psychotic disorders: replication in schizophrenia and extension to bipolar disorder with psychosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17343851 2007 Proteomic surveillance of autoimmunity in Behcet's disease with uveitis: selenium binding protein is a novel autoantigen in Behcet's disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16645984 2006 Suppression of human selenium-binding protein 1 is a late event in colorectal carcinogenesis and is associated with poor survival.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16380993 2006 Selenium binding protein 1 in ovarian cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16223876 2005 Comparative gene expression analysis of blood and brain provides concurrent validation of SELENBP1 up-regulation in schizophrenia.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15108003 2004 Localization of selenium-binding protein at the tips of rapidly extending protrusions.
14991897 2004 Reduced selenium-binding protein 1 expression is associated with poor outcome in lung adenocarcinomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10799528 2000 A 56-kDa selenium-binding protein participates in intra-Golgi protein transport.
9679983 1998 Differential expression and androgen regulation of the human selenium-binding protein gene hSP56 in prostate cancer cells.
9027582 1997 Isolation, characterization, and chromosomal mapping of a novel cDNA clone encoding human selenium binding protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8453708 1993 Different patterns of regulation of the genes encoding the closely related 56 kDa selenium- and acetaminophen-binding proteins in normal tissues and during carcinogenesis.
8157642 1994 Characterization of the protein-protein interactions determining the heat shock protein (hsp90.hsp70.hsp56) heterocomplex.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1553752 1992 Purification, antibody production, and partial amino acid sequence of the 58-kDa acetaminophen-binding liver proteins.