Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.32
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.269 1.3e-02
astrocytic glioma -1.700 1.6e-02
ependymoma -1.800 3.2e-02
atypical teratoid / rhabdoid tumor -1.300 2.5e-04
medulloblastoma, large-cell 1.800 1.8e-06
Amyotrophic Lateral Sclerosis 1.120 8.1e-06
acute quadriplegic myopathy 1.655 3.4e-06
lung cancer 1.600 1.2e-03
subependymal giant cell astrocytoma -1.073 1.7e-02
ovarian cancer -1.600 1.0e-04
Breast cancer 1.300 5.2e-04
dermatomyositis 2.000 1.5e-04

 MGI Phenotype (1)

Gene RIF (3)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with SEH1-like (SEH1L) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21825076 The assembly of soluble Nup107-160 complexes into higher order structures occurs only at sites on the chromatin surface that are already covered with the nuclear envelope.
14517296 Sec13 stably interacts with Nup96 at the NPC during interphase and the shuttling of Sec13 between the nucleus and the cytoplasm may couple and regulate functions between these two compartments

AA Sequence

MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEF      1 - 70
GQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVR     71 - 140
IYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYA    141 - 210
KAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQ    211 - 280
VWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSL    281 - 350
NGSSAGRKHS                                                                351 - 360
//

Text Mined References (23)

PMID Year Title
27487210 2016 Mechanism of arginine sensing by CASTOR1 upstream of mTORC1.
27194810 2016 Systematic Protein-Protein Interaction Analysis Reveals Intersubcomplex Contacts in the Nuclear Pore Complex.
26972053 2016 The CASTOR Proteins Are Arginine Sensors for the mTORC1 Pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26391640 2015 Crystal structure of human nuclear pore complex component NUP43.
25457612 2014 Sestrins inhibit mTORC1 kinase activation through the GATOR complex.
25263562 2014 The Sestrins interact with GATOR2 to negatively regulate the amino-acid-sensing pathway upstream of mTORC1.
24315095 2013 Integrated structural analysis of the human nuclear pore complex scaffold.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21825076 2011 Formation of the postmitotic nuclear envelope from extended ER cisternae precedes nuclear pore assembly.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17363900 2007 The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions.
17360435 2007 Cell-cycle-dependent phosphorylation of the nuclear pore Nup107-160 subcomplex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146057 2004 The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517296 2003 Sec13 shuttles between the nucleus and the cytoplasm and stably interacts with Nup96 at the nuclear pore complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
12196509 2002 Proteomic analysis of the mammalian nuclear pore complex.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.