Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.01
PubTator Score 25.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -3.700 1.9e-07
cutaneous lupus erythematosus 1.900 1.3e-03
psoriasis 1.300 5.2e-03
medulloblastoma, large-cell -1.100 8.0e-03
Atopic dermatitis 1.200 2.6e-04
tuberculosis 1.600 2.5e-05
intraductal papillary-mucinous adenoma (... -1.100 3.2e-03
X-linked cerebral adrenoleukodystrophy -1.500 3.3e-02
breast carcinoma 1.200 5.4e-03
subependymal giant cell astrocytoma 1.057 2.1e-02
inflammatory breast cancer 1.800 3.1e-02
lung carcinoma -1.700 7.7e-17
mucosa-associated lymphoid tissue lympho... 1.766 1.5e-02
ovarian cancer 1.200 1.4e-03

Gene RIF (6)

PMID Text
24211252 SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells.
24157461 CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues
21749909 level of SECTM1 expression is likely to be a key factor in innate immune responses and in the immune tolerance of cancerous cells
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRA      1 - 70
HGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQS     71 - 140
APDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELW    141 - 210
TPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP                                    211 - 248
//

Text Mined References (18)

PMID Year Title
24211252 2014 Autocrine GM-CSF transcription in the leukemic progenitor cell line KG1a is mediated by the transcription factor ETS1 and is negatively regulated through SECTM1 mediated ligation of CD7.
24157461 2014 SECTM1 produced by tumor cells attracts human monocytes via CD7-mediated activation of the PI3K pathway.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21749909 2011 The T/NK cell co-stimulatory molecule SECTM1 is an IFN "early response gene" that is negatively regulated by LPS in human monocytic cells.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15742156 2005 Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10652336 2000 Identification of CD7 as a cognate of the human K12 (SECTM1) protein.
9480746 1998 Identification and characterization of K12 (SECTM1), a novel human gene that encodes a Golgi-associated protein with transmembrane and secreted isoforms.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.