Property Summary

NCBI Gene PubMed Count 33
PubMed Score 105.71
PubTator Score 86.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.514 6.0e-05
primitive neuroectodermal tumor 1.100 6.5e-05
Pick disease 1.100 1.7e-05
ovarian cancer -2.100 2.1e-09

Gene RIF (16)

PMID Text
24850884 SBP2 makes direct contacts with a discrete region of the human 28S rRNA.
22308032 Selenocysteine insertion sequence (SECIS)-binding protein 2 alters conformational dynamics of residues involved in tRNA accommodation in 80 S ribosomes.
22247018 The patient showed typical symptoms of SBP2 deficiency, and novel compound heterozygous mutations were identified in SBP2 (p.M515fsX563/p.Q79X).
21084748 Describe subjects with compound heterozygous defects in the SECISBP2 gene. These individuals have reduced synthesis of most of the 25 known human selenoproteins, resulting in a complex phenotype.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20378690 Observational study of gene-disease association. (HuGE Navigator)
19803747 Results demonstrate that SECIS-binding protein 2 is required for protection against reactive oxygen species-induced cellular damage and cell survival.
19602558 SBP2 gene mutation producing early arrest in synthesis of full-length molecule. Demonstration that SBP2 isoforms containing all functional domains could be synthesized from three downstream ATGs explains the relatively mild phenotype caused by this defect
19467292 ca. 70% of the SBP2 sequence is disordered, whereas the RNA binding domain appears to be folded and functional.
19265499 Seleniuim is obviously not a limiting factor in the SBP2 deficient individuals when regular daily selenium intake is provided
19106619 CUG-BP1 and HuR act as factors that bind to the SBP2 3' UTR, which suggests that TTR-RBPs play a role in the regulation of SBP2
19004874 A report of a complex splicing pattern in the 5'-region of human SECISBP2, wherein at least eight splice variants encode five isoforms with varying N-terminal sequence.
18948268 SECIS binding induces a conformational change in SBP2 that recruits eEFSec, which in concert with the Sec incorporation domain gains access to the ribosomal A site
17846120 Data suggest that SBP2 is a major determinant in dictating the hierarchy of selenoprotein synthesis via differential selenoprotein mRNA translation and sensitivity to nonsense-mediated decay.
16782878 Oxidative stress induces nuclear accumulation of SBP2 via oxidation of cysteine residues within a redox-sensitive cysteine-rich domain.
12403468 In addition to identifying key amino acids for SECIS recognition by SBP2, our findings led to the proposal that some of the recognition principles governing the 15.5 kD-U4 snRNA interaction must be similar in the SBP2-SECIS RNA complex

AA Sequence

MASEGPREPESEGIKLSADVKPFVPRFAGLNVAWLESSEACVFPSSAATYYPFVQEPPVTEQKIYTEDMA      1 - 70
FGASTFPPQYLSSEITLHPYAYSPYTLDSTQNVYSVPGSQYLYNQPSCYRGFQTVKHRNENTCPLPQEMK     71 - 140
ALFKKKTYDEKKTYDQQKFDSERADGTISSEIKSARGSHHLSIYAENSLKSDGYHKRTDRKSRIIAKNVS    141 - 210
TSKPEFEFTTLDFPELQGAENNMSEIQKQPKWGPVHSVSTDISLLREVVKPAAVLSKGEIVVKNNPNESV    211 - 280
TANAATNSPSCTRELSWTPMGYVVRQTLSTELSAAPKNVTSMINLKTIASSADPKNVSIPSSEALSSDPS    281 - 350
YNKEKHIIHPTQKSKASQGSDLEQNEASRKNKKKKEKSTSKYEVLTVQEPPRIEDAEEFPNLAVASERRD    351 - 420
RIETPKFQSKQQPQDNFKNNVKKSQLPVQLDLGGMLTALEKKQHSQHAKQSSKPVVVSVGAVPVLSKECA    421 - 490
SGERGRRMSQMKTPHNPLDSSAPLMKKGKQREIPKAKKPTSLKKIILKERQERKQRLQENAVSPAFTSDD    491 - 560
TQDGESGGDDQFPEQAELSGPEGMDELISTPSVEDKSEEPPGTELQRDTEASHLAPNHTTFPKIHSRRFR    561 - 630
DYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEK    631 - 700
IQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAAR    701 - 770
QAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEE    771 - 840
SLEASTSQMMNLNL                                                            841 - 854
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24850884 2014 The SBP2 protein central to selenoprotein synthesis contacts the human ribosome at expansion segment 7L of the 28S rRNA.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22308032 2012 Selenocysteine insertion sequence (SECIS)-binding protein 2 alters conformational dynamics of residues involved in tRNA accommodation in 80 S ribosomes.
22247018 2012 Novel compound heterozygous mutations in the SBP2 gene: characteristic clinical manifestations and the implications of GH and triiodothyronine in longitudinal bone growth and maturation.
21084748 2010 Mutations in the selenocysteine insertion sequence-binding protein 2 gene lead to a multisystem selenoprotein deficiency disorder in humans.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20378690 2010 Genetic variants in selenoprotein genes increase risk of colorectal cancer.
19803747 2010 SECIS-binding protein 2 promotes cell survival by protecting against oxidative stress.
19602558 2009 Clinical and molecular characterization of a novel selenocysteine insertion sequence-binding protein 2 (SBP2) gene mutation (R128X).
19467292 2009 SECIS-binding protein 2, a key player in selenoprotein synthesis, is an intrinsically disordered protein.
19265499 2009 Selenium supplementation fails to correct the selenoprotein synthesis defect in subjects with SBP2 gene mutations.
19106619 Known turnover and translation regulatory RNA-binding proteins interact with the 3' UTR of SECIS-binding protein 2.
19004874 2008 Functional characterization of alternatively spliced human SECISBP2 transcript variants.
18948268 2008 A novel protein domain induces high affinity selenocysteine insertion sequence binding and elongation factor recruitment.
17846120 2007 SBP2 binding affinity is a major determinant in differential selenoprotein mRNA translation and sensitivity to nonsense-mediated decay.
17332014 2007 An improved definition of the RNA-binding specificity of SECIS-binding protein 2, an essential component of the selenocysteine incorporation machinery.
16962588 2006 Identification and characterization of selenoprotein K: an antioxidant in cardiomyocytes.
16782878 2006 The redox state of SECIS binding protein 2 controls its localization and selenocysteine incorporation function.
16381901 2006 The LIFEdb database in 2006.
16228000 2005 Mutations in SECISBP2 result in abnormal thyroid hormone metabolism.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403468 2002 The SBP2 and 15.5 kD/Snu13p proteins share the same RNA binding domain: identification of SBP2 amino acids important to SECIS RNA binding.
12095701 2002 cDNA cloning, expression pattern and RNA binding analysis of human selenocysteine insertion sequence (SECIS) binding protein 2.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11118223 2000 SECIS-SBP2 interactions dictate selenocysteine incorporation efficiency and selenoprotein hierarchy.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10637234 2000 A novel RNA binding protein, SBP2, is required for the translation of mammalian selenoprotein mRNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.