Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.21
PubTator Score 5.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.315 1.4e-02
Multiple myeloma 1.491 2.0e-04
glioblastoma 2.000 4.5e-02
osteosarcoma 2.206 4.2e-04
pancreatic ductal adenocarcinoma liver m... -1.244 3.4e-02
lung cancer 1.100 1.3e-02
diabetes mellitus -1.100 6.0e-03
adult high grade glioma 1.300 1.3e-02
group 3 medulloblastoma 1.200 2.2e-03
ovarian cancer 2.300 8.8e-06

Protein-protein Interaction (7)

Gene RIF (2)

PMID Text
24497544 Cotransin, a substrate-selective Sec61 inhibitor, traps nascent transmembrane domains in the cytosolic vestibule, permitting detailed interrogation of an early pre-integration intermediate.
18976975 Knockdown of Sec61 gamma subunit (SEC61G) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG        1 - 68
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24497544 2014 An allosteric Sec61 inhibitor traps nascent transmembrane helices at the lateral gate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10212142 1999 The Sec61 complex is located in both the ER and the ER-Golgi intermediate compartment.
9631292 1998 The role of assembly in insulin's biosynthesis.
9565615 1998 Calnexin and other factors that alter translocation affect the rapid binding of ubiquitin to apoB in the Sec61 complex.
8945469 1996 Sec61-mediated transfer of a membrane protein from the endoplasmic reticulum to the proteasome for destruction.
8107851 1994 Evolutionary conservation of components of the protein translocation complex.