Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.24
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 1.0e-04
Breast cancer 1.500 5.3e-16
ependymoma -1.200 3.1e-02
glioblastoma multiforme -1.200 4.1e-21
group 3 medulloblastoma -1.200 2.3e-02
invasive ductal carcinoma 1.400 1.1e-02
lung cancer 1.600 7.2e-04
lung carcinoma 1.400 2.4e-32
osteosarcoma -1.760 3.1e-05
pancreatic ductal adenocarcinoma liver m... -1.089 2.2e-02
Pick disease -1.500 1.2e-04

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILA      1 - 70
SNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDP     71 - 140
AEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFE    141 - 210
GAVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYP    211 - 280
IKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPES    281 - 350
MGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTA    351 - 420
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF                  421 - 476
//

Text Mined References (10)

PMID Year Title