Property Summary

NCBI Gene PubMed Count 26
PubMed Score 280.20
PubTator Score 189.06

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (13)

PMID Text
26356418 Nuclear envelope associated endosome-mediated transfer depends on the nuclear envelope proteins SUN1 and SUN2, as well as the Sec61 translocon complex.
26085089 BiP facilitates Sec61 channel closure (i.e. limits ER Ca(2+) leakage) via the Sec61 channel with the help of ERj3 and ERj6
24934166 Sec61 complex is calcium permeable, the Sec61 complex is tightly regulated in its equilibrium between the closed and open conformations, or "gated", by ligands, such as signal peptides of the transport substrates
24497544 Cotransin, a substrate-selective Sec61 inhibitor, traps nascent transmembrane domains in the cytosolic vestibule, permitting detailed interrogation of an early pre-integration intermediate.
23125841 Tandem affinity purification and mass spectrometry analysis identify Sec61 alpha 1 subunit (SEC61A1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22796945 BiP limits ER Ca(2+) leakage through the Sec61 complex by binding to the ER lumenal loop 7 of Sec61alpha in the vicinity of tyrosine 344.
22505607 Short secretory proteins appear to be ubiquitously transported across the ER membrane through the Sec61 translocon.
22375059 The human SEC61A1 gene is essential for cell growth and viability.
22190034 Tandem affinity purification and mass spectrometry analysis identify Sec61 alpha 1 subunit (SEC61A1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21987770 The present study indicates that Sec61alpha is a host protein involved in Ebola virus (EBOV) replication, specifically in EBOV genome transcription and replication.
21406962 Silencing the SEC61A1 gene using two different siRNAs in HeLa cells for 96 hours had little effect on cell growth and viability. However, calcium leakage from the ER was greatly decreased in the SEC61A1-silenced cells.
21102557 At the cellular level, two different calmodulin antagonists stimulated calcium release from the endoplasmic reticulum through SEC61 channels.
18480044 analysis of translocation through the Sec61 translocon by the nascent polypeptide structure within the ribosome

AA Sequence

MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILA      1 - 70
SNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDP     71 - 140
SEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFE    141 - 210
GAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYP    211 - 280
IKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPES    281 - 350
FGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA    351 - 420
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF                  421 - 476
//

Text Mined References (30)

PMID Year Title
27392076 2016 Heterozygous Loss-of-Function SEC61A1 Mutations Cause Autosomal-Dominant Tubulo-Interstitial and Glomerulocystic Kidney Disease with Anemia.
26356418 2015 Nuclear envelope-associated endosomes deliver surface proteins to the nucleus.
26085089 2015 Co-chaperone Specificity in Gating of the Polypeptide Conducting Channel in the Membrane of the Human Endoplasmic Reticulum.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24934166 2014 Protein transport into the human ER and related diseases, Sec61-channelopathies.
24497544 2014 An allosteric Sec61 inhibitor traps nascent transmembrane helices at the lateral gate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22796945 2012 BiP-mediated closing of the Sec61 channel limits Ca2+ leakage from the ER.
22505607 2012 TRC40 can deliver short secretory proteins to the Sec61 translocon.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
22314232 2012 Palmitoylated calnexin is a key component of the ribosome-translocon complex.
21987770 2011 Contribution of Sec61? to the life cycle of Ebola virus.
21406962 Sec61 complexes form ubiquitous ER Ca2+ leak channels.
21269460 2011 Initial characterization of the human central proteome.
21102557 2011 Interaction of calmodulin with Sec61? limits Ca2+ leakage from the endoplasmic reticulum.
18480044 2008 Control of translocation through the Sec61 translocon by nascent polypeptide structure within the ribosome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11054417 2001 Newly synthesized human delta opioid receptors retained in the endoplasmic reticulum are retrotranslocated to the cytosol, deglycosylated, ubiquitinated, and degraded by the proteasome.
10601334 1999 Stress-associated endoplasmic reticulum protein 1 (SERP1)/Ribosome-associated membrane protein 4 (RAMP4) stabilizes membrane proteins during stress and facilitates subsequent glycosylation.
10212142 1999 The Sec61 complex is located in both the ER and the ER-Golgi intermediate compartment.
9792704 1998 The mechanism underlying cystic fibrosis transmembrane conductance regulator transport from the endoplasmic reticulum to the proteasome includes Sec61beta and a cytosolic, deglycosylated intermediary.
9631292 1998 The role of assembly in insulin's biosynthesis.
9565615 1998 Calnexin and other factors that alter translocation affect the rapid binding of ubiquitin to apoB in the Sec61 complex.
9512475 1998 Membrane integration of Sec61alpha: a core component of the endoplasmic reticulum translocation complex.
8945469 1996 Sec61-mediated transfer of a membrane protein from the endoplasmic reticulum to the proteasome for destruction.