Property Summary

NCBI Gene PubMed Count 21
PubMed Score 9.20
PubTator Score 8.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma 1.100 1.1e-02
osteosarcoma -1.124 6.5e-03
astrocytoma 1.300 4.6e-03
intraductal papillary-mucinous adenoma (... 1.100 3.5e-04
ovarian cancer 1.900 7.3e-06

 GO Function (1)

Gene RIF (7)

PMID Text
23658022 Data indicate that a synthetic polypeptide containing the N terminus of bovine AE1 bound the Sec23A-Sec24C complex through a selective interaction with Sec24C.
23288844 a lysine residing in the C terminus of the serotonin transporter specifies its preference for the coat protein complex II component SEC24C
22404651 A triple arg motif mediates alpha(2B)-adrenergic receptor interaction with Sec24C/D and export
21454670 The serotonin transporter is an exclusive client of the coat protein complex II (COPII) component SEC24C
18329616 We found that Sec24C, a component of the host COPII vesicular transport system, interacts specifically with VP40 via VP40 amino acids 303 to 307.
17373700 Observational study of gene-disease association. (HuGE Navigator)
15013749 The interphase form of Sec24Cp was O-N-acetylglucosamine modified, a feature lost upon entering into mitosis. This mitotic deglycosylation was coupled to Sec24p phosphorylation, a process which may contribute to observed mitotic ER-to-Golgi traffic block.

AA Sequence

MNVNQSVPPVPPFGQPQPIYPGYHQSSYGGQSGSTAPAIPYGAYNGPVPGYQQTPPQGMSRAPPSSGAPP      1 - 70
ASTAQAPCGQAAYGQFGQGDVQNGPSSTVQMQRLPGSQPFGSPLAPVGNQPPVLQPYGPPPTSAQVATQL     71 - 140
SGMQISGAVAPAPPSSGLGFGPPTSLASASGSFPNSGLYGSYPQGQAPPLSQAQGHPGIQTPQRSAPSQA    141 - 210
SSFTPPASGGPRLPSMTGPLLPGQSFGGPSVSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQP    211 - 280
QQNGSFGPARGPQSNYGGPYPAAPTFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVR    281 - 350
GQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGES    351 - 420
GPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATV    421 - 490
DYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGAEESAIRVGFVTYNKVLHFYN    491 - 560
VKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVITSLLDQIPEMFADTRETETVFVPVIQAGMEAL    561 - 630
KAAECAGKLFLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFP    631 - 700
NQYVDVATLSVVPQLTGGSVYKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAF    701 - 770
YMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYR    771 - 840
NCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNC    841 - 910
VLKSDVLQPGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVESTTEPPAVRASEERLSNGDI    911 - 980
YLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLT    981 - 1050
VVKQEDKMEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQLLS                             1051 - 1094
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23658022 2013 A new class of endoplasmic reticulum export signal PhiXPhiXPhi for transmembrane proteins and its selective interaction with Sec24C.
23288844 2013 Switching the clientele: a lysine residing in the C terminus of the serotonin transporter specifies its preference for the coat protein complex II component SEC24C.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22404651 2012 A triple arg motif mediates ?(2B)-adrenergic receptor interaction with Sec24C/D and export.
21454670 2011 The serotonin transporter is an exclusive client of the coat protein complex II (COPII) component SEC24C.
21269460 2011 Initial characterization of the human central proteome.
20427317 2010 Selective export of human GPI-anchored proteins from the endoplasmic reticulum.
18692470 2008 Structural basis for cargo regulation of COPII coat assembly.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18329616 2008 Ebola virus matrix protein VP40 uses the COPII transport system for its intracellular transport.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15899885 2005 Insig required for sterol-mediated inhibition of Scap/SREBP binding to COPII proteins in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15013749 2004 Regulation of a COPII component by cytosolic O-glycosylation during mitosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11252894 2000 Three ways to make a vesicle.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10329445 1999 A family of mammalian proteins homologous to yeast Sec24p.
10214955 1999 Hypothetical protein KIAA0079 is a mammalian homologue of yeast Sec24p.
10075675 1999 Sec24 proteins and sorting at the endoplasmic reticulum.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.