Property Summary

NCBI Gene PubMed Count 38
PubMed Score 87.13
PubTator Score 202.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (19)

AA Sequence

MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDN      1 - 70
IISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTT     71 - 140
KLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLS    141 - 210
EDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEH    211 - 280
SVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPED    281 - 350
GTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK                     351 - 403
//

Text Mined References (40)

PMID Year Title