Property Summary

NCBI Gene PubMed Count 15
PubMed Score 192.67
PubTator Score 242.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession P20132 A8K9P5 SDH
Symbols SDH

Gene

SDS

PANTHER Protein Class (2)

PDB

1P5J   4H27  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
23112234 S84A serine racemase mutant behaved like serine dehydratase, whereas A65S serine dehydratase mutant acquired an additional function of using D-serine as a substrate.
18289528 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGM      1 - 70
AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPL     71 - 140
IWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKL    141 - 210
VSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSH    211 - 280
VIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK                          281 - 328
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23112234 2012 Modulating the function of human serine racemase and human serine dehydratase by protein engineering.
18342636 2008 A catalytic mechanism that explains a low catalytic activity of serine dehydratase like-1 from human cancer cells: crystal structure and site-directed mutagenesis studies.
18289528 2008 Association between sorbitol dehydrogenase gene polymorphisms and type 2 diabetic retinopathy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15689518 2005 Crystal structure of the pyridoxal-5'-phosphate-dependent serine dehydratase from human liver.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14646100 2003 Crystallization and preliminary crystallographic analysis of human serine dehydratase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10347152 1999 Flux of the L-serine metabolism in rabbit, human, and dog livers. Substantial contributions of both mitochondrial and peroxisomal serine:pyruvate/alanine:glyoxylate aminotransferase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2674117 1989 Human liver serine dehydratase. cDNA cloning and sequence homology with hydroxyamino acid dehydratases from other sources.
435568 1979 [Kinetic and allosteric properties of L-threonine-L-serine dehydratase from human liver].
163697 1975 The regulation of serine dehydratase and glucose-6-phosphatase in hyperplastic nodules of rat liver during diethylnitrosamine and N-2-fluorenylacetamide feeding.
163593 1975 Immunohistochemical demonstration of serine dehydratase in rat liver.
31199 1978 [Detection and properties of L-threonine-L-serine dehydratase in human liver].