Property Summary

NCBI Gene PubMed Count 8
PubMed Score 44.87
PubTator Score 11.37

Knowledge Summary


No data available


  Disease (3)


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 1.7e-35

Gene RIF (1)

AA Sequence

LDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV                                         281 - 313

Text Mined References (10)

PMID Year Title