Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
interstitial cystitis 2312 5.0e-03
osteosarcoma 7950 7.3e-03
astrocytic glioma 2597 1.0e-02
oligodendroglioma 2850 3.9e-02
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.800 1.0e-02
interstitial cystitis -1.200 5.0e-03
oligodendroglioma -1.300 3.9e-02
osteosarcoma 1.277 7.3e-03

Gene RIF (1)

AA Sequence

MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEP      1 - 70
LEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF                                     71 - 108
//

Text Mined References (7)

PMID Year Title