Property Summary

NCBI Gene PubMed Count 25
PubMed Score 69.53
PubTator Score 70.12

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

AA Sequence

MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARL      1 - 70
LYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMALL     71 - 140
RDFAKNKNKEQRLRAPDLEYLFEKPR                                                141 - 166
//

Text Mined References (26)

PMID Year Title