Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.35
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.203 2.2e-02
interstitial cystitis 1.400 1.2e-03
invasive ductal carcinoma 1.300 8.6e-03
malignant mesothelioma 1.400 3.4e-06
non primary Sjogren syndrome sicca 1.400 1.9e-02
pancreatic ductal adenocarcinoma liver m... -2.540 6.6e-04
psoriasis 1.500 3.0e-03
ulcerative colitis 1.400 2.2e-06
Waldenstrons macroglobulinemia 1.162 1.9e-02

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MWSAGRGGAAWPVLLGLLLALLVPGGGAAKTGAELVTCGSVLKLLNTHHRVRLHSHDIKYGSGSGQQSVT      1 - 70
GVEASDDANSYWRIRGGSEGGCPRGSPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGD     71 - 140
DLDLWTVRCSGQHWEREAAVRFQHVGTSVFLSVTGEQYGSPIRGQHEVHGMPSANTHNTWKAMEGIFIKP    141 - 210
SVEPSAGHDEL                                                               211 - 221
//

Text Mined References (11)

PMID Year Title