Property Summary

NCBI Gene PubMed Count 10
PubMed Score 22.67
PubTator Score 6.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8297 1.7e-03
breast carcinoma 1589 1.2e-02

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.100 1.2e-02
ovarian cancer 1.100 1.7e-03

Synonym

Accession Q99470 Q9BQ79 SDF-2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (7)

AA Sequence

MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYW      1 - 70
RIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGP     71 - 140
YWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAE    141 - 210
L//

Text Mined References (12)

PMID Year Title